| Clone Name | bastl06a01 |
|---|---|
| Clone Library Name | barley_pub |
>BIOH_VIBVY (Q7MPY0) Carboxylesterase bioH (EC 3.1.1.1) (Biotin synthesis| protein bioH) Length = 255 Score = 32.3 bits (72), Expect = 0.77 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 461 LAVEDLEYAGHAAHLAAVELRHVVSQGVEHPPRR 360 L V DL GH+AHL A L + Q +EH P++ Sbjct: 42 LHVVDLPGYGHSAHLHAASLEEIAQQLLEHAPKQ 75
>BIOH_VIBVU (Q8DDU4) Carboxylesterase bioH (EC 3.1.1.1) (Biotin synthesis| protein bioH) Length = 255 Score = 32.3 bits (72), Expect = 0.77 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 461 LAVEDLEYAGHAAHLAAVELRHVVSQGVEHPPRR 360 L V DL GH+AHL A L + Q +EH P++ Sbjct: 42 LHVVDLPGYGHSAHLHAASLEEIAQQLLEHAPKQ 75
>RSMB_ERIEU (Q9TU67) Small nuclear ribonucleoprotein-associated protein B'| (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 30.8 bits (68), Expect = 2.2 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +2 Query: 401 GVRPPPDGLHGRHIPDLRPP 460 G+RPPP G+ G P LRPP Sbjct: 219 GMRPPPPGMRGPPPPGLRPP 238
>RSMN_RAT (P63164) Small nuclear ribonucleoprotein-associated protein N| (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) Length = 240 Score = 30.0 bits (66), Expect = 3.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 401 GVRPPPDGLHGRHIPDLRPP 460 G+RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGIRGPPPPGMRPP 238
>RSMN_MOUSE (P63163) Small nuclear ribonucleoprotein-associated protein N| (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein) Length = 240 Score = 30.0 bits (66), Expect = 3.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 401 GVRPPPDGLHGRHIPDLRPP 460 G+RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGIRGPPPPGMRPP 238
>RSMN_HUMAN (P63162) Small nuclear ribonucleoprotein-associated protein N| (snRNP-N) (Sm protein N) (Sm-N) (SmN) (Sm-D) (Tissue-specific splicing protein) Length = 240 Score = 30.0 bits (66), Expect = 3.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 401 GVRPPPDGLHGRHIPDLRPP 460 G+RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGIRGPPPPGMRPP 238
>RSMB_MONDO (Q9TU66) Small nuclear ribonucleoprotein-associated protein B'| (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 30.0 bits (66), Expect = 3.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 401 GVRPPPDGLHGRHIPDLRPP 460 G+RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGMRGPPPPGMRPP 238
>RSMB_HUMAN (P14678) Small nuclear ribonucleoprotein-associated proteins B and| B' (snRNP-B) (Sm protein B/B') (Sm-B/Sm-B') (SmB/SmB') Length = 240 Score = 30.0 bits (66), Expect = 3.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 401 GVRPPPDGLHGRHIPDLRPP 460 G+RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGMRGPPPPGMRPP 238
>RSMB_CHICK (Q9PV94) Small nuclear ribonucleoprotein-associated protein B'| (snRNP-B') (Sm protein B') (Sm-B') (SmB') (snRPB') Length = 240 Score = 30.0 bits (66), Expect = 3.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +2 Query: 401 GVRPPPDGLHGRHIPDLRPP 460 G+RPPP G+ G P +RPP Sbjct: 219 GMRPPPPGMRGPPPPGMRPP 238
>RD23B_MOUSE (P54728) UV excision repair protein RAD23 homolog B (mHR23B) (XP-C| repair-complementing complex 58 kDa protein) (p58) Length = 416 Score = 30.0 bits (66), Expect = 3.8 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -3 Query: 436 PAMQPIWRRSNSGMSSAKALSTPLAAGITQRSQTDQTPAQTRIAAS 299 PA+ P +++ +S A S P AG TQ + + PAQT + S Sbjct: 115 PALAPTSTPASTTPASTTASSEPAPAGATQPEKPAEKPAQTPVLTS 160
>MRP10_ARATH (Q9LZJ5) Multidrug resistance-associated protein 10 (EC 3.6.3.44)| (Glutathione S-conjugate transporting ATPase 10) (ATP-energized glutathione S-conjugate pump 10) Length = 1539 Score = 29.6 bits (65), Expect = 5.0 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = -3 Query: 403 SGMSSAKALSTPLAAGITQRSQTDQTPAQTRIAASH 296 +G +SA A + P+A+ ITQRS + ++P Q + H Sbjct: 872 AGSASATAANVPMASPITQRSISIESPRQPKSPKVH 907
>VCAP_SHV21 (Q00999) Major capsid protein (MCP)| Length = 1371 Score = 29.3 bits (64), Expect = 6.5 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +3 Query: 3 HPTQPVFSSAHEAAARMSEWRSNHRHK**NIPPPNSQRPSQE 128 HP V++ H+ AA ++R+ HR+ N+PPP + QE Sbjct: 533 HPFFDVYAERHQGAA--VQYRATHRNLSGNLPPPLAPYSFQE 572
>NPT3_HUMAN (O00624) Sodium-dependent phosphate transport protein 3| (Sodium/phosphate cotransporter 3) (Na(+)/PI cotransporter 3) (Solute carrier family 18 member 2) Length = 436 Score = 28.9 bits (63), Expect = 8.5 Identities = 11/43 (25%), Positives = 19/43 (44%) Frame = +3 Query: 312 LVWAGV*SVWERWVMPAARGVLNALADDMPEFDRRQMGCMAGI 440 + W G ++W +W P R L +A F + C+ G+ Sbjct: 160 MAWTGQFTIWAKWAPPLERSKLTTIAGSGSAFGSFIILCVGGL 202
>SC24C_ARATH (Q9M291) Protein transport protein Sec24-like CEF| Length = 1097 Score = 28.9 bits (63), Expect = 8.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 410 PPPDGLHGRHIPDLRPPADAHGAS 481 PPP G+HG H+ + PP+ G + Sbjct: 197 PPPSGMHGGHLSNGPPPSGMPGGT 220 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,643,952 Number of Sequences: 219361 Number of extensions: 1118846 Number of successful extensions: 3458 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 3314 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3448 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)