| Clone Name | bastl05h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRAF2_HUMAN (Q12933) TNF receptor-associated factor 2 (Tumor nec... | 29 | 4.9 | 2 | BCR_HUMAN (P11274) Breakpoint cluster region protein (EC 2.7.11.... | 29 | 4.9 |
|---|
>TRAF2_HUMAN (Q12933) TNF receptor-associated factor 2 (Tumor necrosis factor| type 2 receptor-associated protein 3) Length = 501 Score = 28.9 bits (63), Expect = 4.9 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 332 CSQKKIPRSSFHTIIEECIQIQLPRKIIGLGLPEAGRG 219 C +KKIPR F ++ C + ++P + +G E G Sbjct: 192 CGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEG 229
>BCR_HUMAN (P11274) Breakpoint cluster region protein (EC 2.7.11.1) (NY-REN-26| antigen) Length = 1271 Score = 28.9 bits (63), Expect = 4.9 Identities = 17/43 (39%), Positives = 24/43 (55%) Frame = -1 Query: 325 RRRYREVPFTQLLKSVSKSSYREK**ALGFQRQAEAPTGASLP 197 + R+R + LL KS R++ GF+R A+AP GAS P Sbjct: 51 QERFRMIYLQTLLAKEKKSYDRQR---WGFRRAAQAPDGASEP 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,683,744 Number of Sequences: 219361 Number of extensions: 664402 Number of successful extensions: 1823 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1755 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1822 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)