| Clone Name | bastl05e04 |
|---|---|
| Clone Library Name | barley_pub |
>NDF2_RAT (Q63689) Neurogenic differentiation factor 2 (NeuroD2) (Brain bHLH| protein KW8) Length = 382 Score = 29.3 bits (64), Expect = 3.9 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +2 Query: 278 LWGGSQHQQPKHGFCKA--TLYERGAGGG 358 L GG+ H HG+C A TLY GGG Sbjct: 257 LGGGAAHALRTHGYCAAYETLYAAAGGGG 285
>NDF2_HUMAN (Q15784) Neurogenic differentiation factor 2 (NeuroD2)| (NeuroD-related factor) (NDRF) Length = 382 Score = 29.3 bits (64), Expect = 3.9 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +2 Query: 278 LWGGSQHQQPKHGFCKA--TLYERGAGGG 358 L GG+ H HG+C A TLY GGG Sbjct: 257 LGGGAAHALRTHGYCAAYETLYAAAGGGG 285
>NDF2_MOUSE (Q62414) Neurogenic differentiation factor 2 (NeuroD2)| (NeuroD-related factor) (NDRF) Length = 383 Score = 29.3 bits (64), Expect = 3.9 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +2 Query: 278 LWGGSQHQQPKHGFCKA--TLYERGAGGG 358 L GG+ H HG+C A TLY GGG Sbjct: 258 LGGGAAHALRTHGYCAAYETLYAAAGGGG 286
>RGYR_PYRAE (Q8ZXT5) Reverse gyrase [Includes: Helicase (EC 3.6.1.-);| Topoisomerase (EC 5.99.1.3)] Length = 1228 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = -1 Query: 347 PLFRKVWLCRSHALVADVD----CRPTVVFASV 261 P++ K+W CR V D+D C+P V ++ Sbjct: 731 PVYNKIWRCRGAVYVDDIDIPPGCKPLDVLEAI 763
>SEC16_YEAST (P48415) Multidomain vesicle coat protein| Length = 2195 Score = 28.5 bits (62), Expect = 6.7 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +3 Query: 219 GSKRARKAMPLSEPHRGKDNCGAAVNISNQSMASAKPHFTKEGP 350 G+K ++K+MP E H DN A N S EGP Sbjct: 1665 GNKHSQKSMPEDESHTSHDNSNADQNTLKDSADVTDETMDIEGP 1708
>SR4_PHYPO (P11113) Spherulin-4 precursor| Length = 332 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 281 WGGSQHQQPKHGFCKATLYERGAGGGGVHSLRA 379 W GS+H P +A RG GGGG H+ A Sbjct: 21 WHGSKHHNPTKAPTEAP--HRGGGGGGGHNTPA 51 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,176,448 Number of Sequences: 219361 Number of extensions: 552435 Number of successful extensions: 1718 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1717 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)