| Clone Name | bastl05b12 |
|---|---|
| Clone Library Name | barley_pub |
>YGY3_HALSQ (P21561) Hypothetical 50.6 kDa protein in the 5'region of gyrA and| gyrB (ORF 3) Length = 437 Score = 31.6 bits (70), Expect = 0.79 Identities = 17/46 (36%), Positives = 20/46 (43%) Frame = -1 Query: 416 GDLAVPAVDDEAAELMLHPLQRHAGPRRASGPTARPRRGRQPQPHA 279 GD P VD + HP RHA R G R +R R+ HA Sbjct: 121 GDRRAPGVDSRLRQQHQHPRGRHASDRVQDGAHPRRQRLREQPRHA 166
>GAG_AVIMC (P03323) Gag polyprotein [Contains: Core protein p19; Core protein| p10; Core protein p27] Length = 453 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 138 APPPPRTARGVFPSVAKRGRREINGG 61 APPPP G++PS+A G ++ GG Sbjct: 170 APPPPYVGSGLYPSLAGVGEQQGQGG 195
>GAG_AVEV1 (P06936) Gag polyprotein (Core polyprotein) [Contains: Core protein| p19; Core protein p23; Core protein p2; Core protein p10] (Fragment) Length = 239 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 138 APPPPRTARGVFPSVAKRGRREINGG 61 APPPP G++PS+A G ++ GG Sbjct: 170 APPPPYVGSGLYPSLAGVGEQQGQGG 195
>GAGC_AVISC (P05433) P47(GAG-CRK) protein| Length = 440 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 138 APPPPRTARGVFPSVAKRGRREINGG 61 APPPP G++PS+A G ++ GG Sbjct: 172 APPPPYVGSGLYPSLAGVGEQQGQGG 197
>VGLD_PRVRI (P07645) Protein gp50| Length = 402 Score = 30.4 bits (67), Expect = 1.8 Identities = 22/73 (30%), Positives = 26/73 (35%), Gaps = 2/73 (2%) Frame = -1 Query: 419 KGDLAVPAVDDEAAELMLHPLQRHAG-PRRASGPTARPRRGRQPQPHADAYPDXXXXXXX 243 K +P A + P + AG PR P RPR +P P A PD Sbjct: 240 KNGRTLPRAHAAATPYAIDPARPSAGSPRPRPRPRPRPRPKPEPAPATPAPPDRLPEPAT 299 Query: 242 XXXXHAGRP-PEP 207 GRP P P Sbjct: 300 RDHAAGGRPTPRP 312
>GAG_FUJSV (P03326) Gag polyprotein [Contains: Core protein p19; Core protein| p10; Core protein p27] Length = 309 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 138 APPPPRTARGVFPSVAKRGRREINGG 61 APPPP G++PS+A G ++ GG Sbjct: 166 APPPPYVGSGLYPSLAGVGEQQGQGG 191
>GAG_RSVP (P03322) Gag polyprotein [Contains: Core protein p19; Core protein| p2A; Core protein p2B; Core protein p10; Capsid protein p27; Inner coat protein p12; Protease p15 (EC 3.4.23.-)] Length = 701 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 138 APPPPRTARGVFPSVAKRGRREINGG 61 APPPP G++PS+A G ++ GG Sbjct: 170 APPPPYVGSGLYPSLAGVGEQQGQGG 195
>GAG_AVEV2 (P06937) Gag polyprotein (Core polyprotein) [Contains: Core protein| p19 beta; Core protein p10] (Fragment) Length = 188 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -3 Query: 138 APPPPRTARGVFPSVAKRGRREINGG 61 APPPP G++PS+A G ++ GG Sbjct: 119 APPPPYVGSGLYPSLAGVGEQQGQGG 144
>ATG7_MAGGR (Q52CS0) Autophagy-related protein 7 (Autophagy-related| E1-like-activating enzyme ATG7) Length = 718 Score = 30.0 bits (66), Expect = 2.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 374 LMLHPLQRHAGPRRASGPTARPRRGRQPQPHA 279 ++ HP + HA +A+GP P R P HA Sbjct: 591 VLQHPQREHAPAPKATGPPGNPEYQRDPPDHA 622
>NCAP_BSCR3 (Q3I5I7) Nucleocapsid protein (N structural protein) (NC)| Length = 421 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 101 GNTPRAVRGGGGAS*LSCLVVDAATSARIAVGGREQAQ 214 GN+P + GGG + L+ L++D V GR Q Q Sbjct: 204 GNSPARMASGGGETALALLLLDRLNQLESKVSGRSQQQ 241
>GAG_AVIMD (P06444) Gag polyprotein [Contains: Core protein p19; Core protein| p10; Core protein p27] Length = 453 Score = 29.3 bits (64), Expect = 3.9 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 138 APPPPRTARGVFPSVAKRGRREINGG 61 APPPP G++PS+A G + GG Sbjct: 170 APPPPYVGSGLYPSLAGVGELQGQGG 195
>KCNG2_HUMAN (Q9UJ96) Potassium voltage-gated channel subfamily G member 2| (Voltage-gated potassium channel subunit Kv6.2) (Cardiac potassium channel subunit) Length = 466 Score = 29.3 bits (64), Expect = 3.9 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = -1 Query: 392 DDEAAELMLHPLQRHA--GPRRASGPTARPRRGRQ 294 ++EAAE P +R A P RA GP R +RGR+ Sbjct: 127 EEEAAEARAGPTERGAQGSPARALGPRGRLQRGRR 161
>TOP1_MYCLE (O69548) DNA topoisomerase 1 (EC 5.99.1.2) (DNA topoisomerase I)| (Omega-protein) (Relaxing enzyme) (Untwisting enzyme) (Swivelase) Length = 947 Score = 28.5 bits (62), Expect = 6.7 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = -1 Query: 419 KGDLAVPAVDDEAAELMLHPLQRHAGPRRASGPTARPRRGRQPQP 285 KGD V D+ AAEL+ RRA GP RP + + P Sbjct: 893 KGDDVVSITDERAAELL--------ADRRARGPVKRPAKKARKVP 929
>MODC_MYCTU (P95155) Molybdenum import ATP-binding protein modC (EC 3.6.3.29)| Length = 369 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 128 GGGAS*LSCLVVDAATSARIAVGGR 202 GG +C+ VDAAT R+A G R Sbjct: 323 GGAPGLAACITVDAATELRVAPGSR 347
>THYG_BOVIN (P01267) Thyroglobulin precursor| Length = 2769 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 169 CVDDQTRELXXXXXXADRARCVPECG*KRA 80 CVD Q REL R RC EC +RA Sbjct: 637 CVDAQGRELAGSRVRGGRPRCPTECEKQRA 666
>GRAC_MOUSE (P08882) Granzyme C precursor (EC 3.4.21.-) (Cytotoxic cell| protease 2) (CCP2) (B10) Length = 248 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = -1 Query: 392 DDEAAELMLHPLQRHAGPRRASGPTARPRRGRQPQPHADAY 270 DD + ++ML L R+A RA P PRR +P + Y Sbjct: 104 DDRSNDIMLLKLVRNAKRTRAVRPLNLPRRNAHVKPGDECY 144
>NCAP_CVHSA (P59595) Nucleocapsid protein (N structural protein) (NC)| Length = 422 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 101 GNTPRAVRGGGGAS*LSCLVVDAATSARIAVGGREQAQ 214 GN+P + GGG + L+ L++D V G+ Q Q Sbjct: 205 GNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQ 242 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,712,038 Number of Sequences: 219361 Number of extensions: 560730 Number of successful extensions: 1837 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1831 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)