| Clone Name | bastl04g06 |
|---|---|
| Clone Library Name | barley_pub |
>PANK2_ARATH (Q8L5Y9) Pantothenate kinase 2 (EC 2.7.1.33) (Pantothenic acid| kinase 2) Length = 870 Score = 100 bits (249), Expect = 2e-21 Identities = 49/59 (83%), Positives = 54/59 (91%) Frame = +1 Query: 259 MNRSGSRPQLDLSGAAIHGTLEDRNPTILLPNQSDDISHLALDIGGSLIKLVYFSRHAD 435 ++RSGSRPQLDLS A I G LE+R+PTILLPNQSDDISHLALDIGGSLIKL+YFSRH D Sbjct: 10 IHRSGSRPQLDLSKAEIQGNLEERDPTILLPNQSDDISHLALDIGGSLIKLLYFSRHED 68
>PANK1_ARATH (O80765) Pantothenate kinase 1 (EC 2.7.1.33) (Pantothenic acid| kinase 1) (AtCoaA) Length = 383 Score = 42.0 bits (97), Expect = 7e-04 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +1 Query: 367 ISHLALDIGGSLIKLVYFSRHADQPTE 447 ISHLALDIGG+LIKLVYFS + D E Sbjct: 6 ISHLALDIGGTLIKLVYFSANGDYSEE 32
>PKCB1_HUMAN (Q9ULU4) Protein kinase C-binding protein 1 (Rack7) (Cutaneous| T-cell lymphoma associated antigen se14-3) (CTCL tumor antigen se14-3) (Zinc finger MYND domain containing protein 8) Length = 1186 Score = 33.1 bits (74), Expect = 0.33 Identities = 22/83 (26%), Positives = 36/83 (43%), Gaps = 10/83 (12%) Frame = +1 Query: 175 PIPEDDVKHEPEAKGKAPAASSXXXXXXMNRSGSRPQLDLSGAA----------IHGTLE 324 P P + V+ + E K +PA+ +++ P+ D S A + G E Sbjct: 636 PKPTNPVEIKEELKSTSPASEKADPGAVKDKASPEPEKDFSEKAKPSPHPIKDKLKGKDE 695 Query: 325 DRNPTILLPNQSDDISHLALDIG 393 +PT+ L SD S L +D+G Sbjct: 696 TDSPTVHLGLDSDSESELVIDLG 718
>PANK2_HUMAN (Q9BZ23) Pantothenate kinase 2, mitochondrial precursor (EC| 2.7.1.33) (Pantothenic acid kinase 2) (hPANK2) Length = 570 Score = 31.2 bits (69), Expect = 1.2 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 12/66 (18%) Frame = +1 Query: 259 MNRSGSRPQLDLSGAAIHGTLEDR-----NPTILLPNQSDDISH-------LALDIGGSL 402 + R S + GA+ GT DR PT + + + + LDIGG+L Sbjct: 163 LRRRASSASVPAVGASAEGTRRDRLGSYSGPTSVSRQRVESLRKKRPLFPWFGLDIGGTL 222 Query: 403 IKLVYF 420 +KLVYF Sbjct: 223 VKLVYF 228
>RD23A_HUMAN (P54725) UV excision repair protein RAD23 homolog A (hHR23A)| Length = 363 Score = 30.0 bits (66), Expect = 2.8 Identities = 19/56 (33%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = +1 Query: 139 PGMAANNSGSEPPIPEDDVKHEPEA--KGKAPAASSXXXXXXMNRSGSRPQLDLSG 300 P A +S S PP P + H P A + K+P+ S + SGS P SG Sbjct: 93 PTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSG 148
>MAP4_HUMAN (P27816) Microtubule-associated protein 4 (MAP 4)| Length = 1152 Score = 29.6 bits (65), Expect = 3.6 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 8/68 (11%) Frame = +1 Query: 178 IPEDDVKHEPEAKGKAP---AASSXXXXXXMNRSGSRPQLDL----SGAAIHGT-LEDRN 333 +P DVK +P A KAP A+ S +RSGS+ + + AA+ T R+ Sbjct: 766 LPSKDVKPKPIADAKAPEKRASPSKPASAPASRSGSKSTQTVAKTTTAAAVASTGPSSRS 825 Query: 334 PTILLPNQ 357 P+ LLP + Sbjct: 826 PSTLLPKK 833
>MANA_RHIME (P29954) Mannose-6-phosphate isomerase (EC 5.3.1.8) (Phosphomannose| isomerase) (PMI) (Phosphohexomutase) Length = 387 Score = 29.3 bits (64), Expect = 4.7 Identities = 20/75 (26%), Positives = 33/75 (44%) Frame = +1 Query: 163 GSEPPIPEDDVKHEPEAKGKAPAASSXXXXXXMNRSGSRPQLDLSGAAIHGTLEDRNPTI 342 G+E D ++ + EA+ K P A GS P + L A + + + Sbjct: 135 GAEMVGRSDKLRRQLEARCKHPLAGFEEDDPPRLPLGSNPHMHLFEACLASEEVEGFDRV 194 Query: 343 LLPNQSDDISHLALD 387 N +D+I+HLA+D Sbjct: 195 AWANLADEIAHLAMD 209
>OXAA_CAUCR (Q9AA40) Inner membrane protein oxaA| Length = 615 Score = 28.5 bits (62), Expect = 8.1 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -1 Query: 395 PPMSRARWEMSSDWLGSRMVGLRSSRVPWMAAP 297 P + W W G+ + GL SR W AAP Sbjct: 121 PEGAEHAWFADFGWAGANLPGLPDSRTVWTAAP 153 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.134 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,233,136 Number of Sequences: 219361 Number of extensions: 773209 Number of successful extensions: 1785 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1783 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)