| Clone Name | bastl04f12 |
|---|---|
| Clone Library Name | barley_pub |
>GLGB_ORYSA (Q01401) 1,4-alpha-glucan branching enzyme, chloroplast precursor| (EC 2.4.1.18) (Starch branching enzyme) (Q-enzyme) Length = 820 Score = 30.0 bits (66), Expect = 1.5 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 8/44 (18%) Frame = +1 Query: 7 CLRSSAQSLTKPLLPATMRRPPRLVVGG--------ASSPSLAW 114 CL SS+ S PLLP+ RP + GG SSP +W Sbjct: 3 CLTSSSSSAPAPLLPSLADRPSPGIAGGGGNVRLSVVSSPRRSW 46
>TGIF_PANTR (Q5IS58) 5'-TG-3'-interacting factor (Homeobox protein TGIF)| Length = 401 Score = 28.9 bits (63), Expect = 3.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 111 CERGRGGSSDYEPWWAAHGGGEE 43 C GG SDY PW A+H G + Sbjct: 17 CSGSGGGGSDYFPWPASHPGNPQ 39
>SHAN2_HUMAN (Q9UPX8) SH3 and multiple ankyrin repeat domains protein 2 (Shank2)| Length = 1253 Score = 28.9 bits (63), Expect = 3.4 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +1 Query: 19 SAQSLTKPLLPATMRRPPRLVVGG--ASSPSLAWRSLCTT 132 SA+ L+ P+ AT R P VGG AS+P A R L +T Sbjct: 541 SAEQLSSPMPSATPREPENHFVGGAEASAPGEAGRPLNST 580
>UBID_ECOLI (P0AAB4) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)| (Polyprenyl p-hydroxybenzoate decarboxylase) Length = 497 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 99 RGGSSDYEPWWAAHGGGEERF 37 RGG+ DY+ W AAH G ERF Sbjct: 197 RGGALDYQEWCAAHPG--ERF 215
>UBID_ECOL6 (P0AAB5) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)| (Polyprenyl p-hydroxybenzoate decarboxylase) Length = 497 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 99 RGGSSDYEPWWAAHGGGEERF 37 RGG+ DY+ W AAH G ERF Sbjct: 197 RGGALDYQEWCAAHPG--ERF 215
>UBID_ECO57 (P58194) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)| (Polyprenyl p-hydroxybenzoate decarboxylase) Length = 497 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 99 RGGSSDYEPWWAAHGGGEERF 37 RGG+ DY+ W AAH G ERF Sbjct: 197 RGGALDYQEWCAAHPG--ERF 215 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.125 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,767,307 Number of Sequences: 219361 Number of extensions: 361060 Number of successful extensions: 1155 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1155 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)