| Clone Name | bastl04d10 |
|---|---|
| Clone Library Name | barley_pub |
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 96.7 bits (239), Expect = 2e-20 Identities = 50/99 (50%), Positives = 66/99 (66%), Gaps = 4/99 (4%) Frame = +1 Query: 160 IRDITGAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGS----HHHEFGSNTPR 327 IRDI AAEA++KEGD F+LIT RWWQ WI+YV QD ++GS H GS+T + Sbjct: 24 IRDIAIAAEANSKEGDTFYLITQRWWQEWIEYVNQDQPCNTNDGSSLSEHCDSPGSSTLK 83 Query: 328 RPGAIDNTNLLDDMASEVSDMQIELHDTLAEGRDYILLP 444 +P IDN++L+ D + E E+ +TL EGRDY+LLP Sbjct: 84 KPSRIDNSDLIYDSSLEDPSNTSEIIETLQEGRDYVLLP 122
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 43.5 bits (101), Expect = 2e-04 Identities = 31/93 (33%), Positives = 44/93 (47%) Frame = +1 Query: 166 DITGAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAID 345 DI + ++GD ++L+ +RW++ W YV DS G + PG ID Sbjct: 15 DIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQN--------VYPGPID 66 Query: 346 NTNLLDDMASEVSDMQIELHDTLAEGRDYILLP 444 N+ LL D D Q L + L + DYILLP Sbjct: 67 NSGLLKD-----GDAQ-SLKEHLIDELDYILLP 93
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 43.5 bits (101), Expect = 2e-04 Identities = 31/93 (33%), Positives = 44/93 (47%) Frame = +1 Query: 166 DITGAAEAHAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAID 345 DI + ++GD ++L+ +RW++ W YV DS G + PG ID Sbjct: 15 DIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQN--------VYPGPID 66 Query: 346 NTNLLDDMASEVSDMQIELHDTLAEGRDYILLP 444 N+ LL D D Q L + L + DYILLP Sbjct: 67 NSGLLKD-----GDAQ-SLKEHLIDELDYILLP 93
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 40.4 bits (93), Expect = 0.002 Identities = 26/83 (31%), Positives = 41/83 (49%) Frame = +1 Query: 196 KEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTNLLDDMAS 375 + G ++LI +RW++ W YV DS + + G H+ PG IDN+ L D S Sbjct: 29 QRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHN--------LFPGPIDNSGLFSDPES 80 Query: 376 EVSDMQIELHDTLAEGRDYILLP 444 + L + L + DY+L+P Sbjct: 81 QT------LKEHLIDELDYVLVP 97
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 40.4 bits (93), Expect = 0.002 Identities = 26/83 (31%), Positives = 41/83 (49%) Frame = +1 Query: 196 KEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTNLLDDMAS 375 + G ++LI +RW++ W YV DS + + G H+ PG IDN+ L D S Sbjct: 29 QRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHN--------LFPGPIDNSGLFSDPES 80 Query: 376 EVSDMQIELHDTLAEGRDYILLP 444 + L + L + DY+L+P Sbjct: 81 QT------LKEHLIDELDYVLVP 97
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 37.7 bits (86), Expect = 0.013 Identities = 26/90 (28%), Positives = 38/90 (42%), Gaps = 3/90 (3%) Frame = +1 Query: 184 EAHAKEGDIFFLITNRWWQSWIDYV---IQDSAGVPSNGSHHHEFGSNTPRRPGAIDNTN 354 E + G+ +FL+ W++ W YV QDS+ PG I+N Sbjct: 50 ERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTF-----------------PGCINNAT 92 Query: 355 LLDDMASEVSDMQIELHDTLAEGRDYILLP 444 L D ++ L + L EG DY+LLP Sbjct: 93 LFQD------EINWRLKEGLVEGEDYVLLP 116
>Y1052_HAEIN (P45008) Putative HTH-type transcriptional regulator HI1052| Length = 298 Score = 31.6 bits (70), Expect = 0.91 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 5/50 (10%) Frame = +1 Query: 190 HAKEGDIFFLITNRWWQSWIDYVIQDSAGVPSNGSHH-----HEFGSNTP 324 H KEGD+FFL N+ + Y A +P+ SH H+ G TP Sbjct: 59 HLKEGDVFFLPQNQ--PHSMHYSANKRADIPTKKSHQGLFELHQIGRGTP 106
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 31.2 bits (69), Expect = 1.2 Identities = 22/93 (23%), Positives = 35/93 (37%), Gaps = 12/93 (12%) Frame = +1 Query: 202 GDIFFLITNRWWQSWIDYVIQD------------SAGVPSNGSHHHEFGSNTPRRPGAID 345 G +F+I+ +WWQ W +YV D + G S G+ H R ++ Sbjct: 393 GHNWFIISMQWWQQWKEYVKYDANPVVIEPSSVLNGGKYSFGTAAHPMEQVEDRIGSSLS 452 Query: 346 NTNLLDDMASEVSDMQIELHDTLAEGRDYILLP 444 N ++ S+ E +T G Y P Sbjct: 453 YVNTTEEKFSDNISTASEASETAGSGFLYSATP 485 Score = 28.5 bits (62), Expect = 7.7 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 5/46 (10%) Frame = +1 Query: 322 PRRPGAIDNTNLLDDMASEVSDMQIE---LHDT--LAEGRDYILLP 444 P++PGAIDN L+ + + + +E L T L GRDY ++P Sbjct: 518 PQKPGAIDNQPLVTQEPVKATSLTLEGGRLKRTPQLIHGRDYEMVP 563
>H1_YEAST (P53551) Histone H1| Length = 258 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +1 Query: 1 EAKPFVYPVAPSKLKEKPNPTLTLAQSSSPAS 96 +AK +AP K+ +K +PT+T ++SSP+S Sbjct: 146 KAKAASTKLAPKKVVKKKSPTVTAKKASSPSS 177 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.132 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,283,280 Number of Sequences: 219361 Number of extensions: 865705 Number of successful extensions: 2159 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2032 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2150 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)