| Clone Name | bastl04b09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PAX8_RAT (P51974) Paired box protein Pax-8 | 29 | 7.2 | 2 | FCA_ARATH (O04425) Flowering time control protein FCA | 28 | 9.4 |
|---|
>PAX8_RAT (P51974) Paired box protein Pax-8| Length = 458 Score = 28.9 bits (63), Expect = 7.2 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 169 PAVASDPAPPQRILRQPFLDLVMVGSGGSLAPHLP 65 P ++S + P + FLDL VGSGG +P Sbjct: 314 PELSSSSSTPSSLSSSAFLDLQQVGSGGPAGASVP 348
>FCA_ARATH (O04425) Flowering time control protein FCA| Length = 747 Score = 28.5 bits (62), Expect = 9.4 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +3 Query: 393 EKPDEKIVLQEKLDEKSVHEEKPDEKQT 476 EKP+E IV + + ++ H+EKP +Q+ Sbjct: 620 EKPEEMIVFEREQQKQQQHQEKPTIQQS 647 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,422,317 Number of Sequences: 219361 Number of extensions: 408179 Number of successful extensions: 1381 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1379 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)