| Clone Name | bastl03h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CD2_HORSE (P37998) T-cell surface antigen CD2 precursor | 29 | 5.7 | 2 | FA11A_HUMAN (Q8NFB2) Protein FAM11A | 28 | 7.4 |
|---|
>CD2_HORSE (P37998) T-cell surface antigen CD2 precursor| Length = 347 Score = 28.9 bits (63), Expect = 5.7 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = -2 Query: 365 KDLLQVVLTNSPGRIICKEKVHQQREHRQD--DADGRGQLEFAFEEHLISLLSAPN 204 KD VL N +I E++H+ ++ D D+DG+ LE F L+ ++S PN Sbjct: 75 KDKTYEVLKNGTLKIKHLERIHEGT-YKVDAYDSDGKNVLEETFHLSLLEMVSKPN 129
>FA11A_HUMAN (Q8NFB2) Protein FAM11A| Length = 350 Score = 28.5 bits (62), Expect = 7.4 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -2 Query: 413 TQWTPQPTGPRLRSKWKDLLQVVLTNSPGRII 318 T+ TP P P++ ++ +VV+T SPG+ + Sbjct: 307 TEETPVPEPPKIAPMFRKKARVVITQSPGKYV 338 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,377,084 Number of Sequences: 219361 Number of extensions: 845355 Number of successful extensions: 1931 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1931 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)