| Clone Name | bastl03g12 |
|---|---|
| Clone Library Name | barley_pub |
>POLN_RRVN (P13887) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC 3.6.1.1 Length = 2479 Score = 31.6 bits (70), Expect = 1.1 Identities = 20/48 (41%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +1 Query: 1 TKPYPTPLPKP-SHRRLPRSAHLRERASGLHLSPSPGRRTSRAQRICS 141 T Y TP+P P + R +P A +RAS +SP+P R RA +CS Sbjct: 1753 TSEYATPIPTPRAVRVVPVPAPRIQRASTYRVSPTPTPRVLRAS-VCS 1799
>POLN_RRVT (P13888) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: Nonstructural protein 3 (nsP3); RNA-directed RNA polymerase nsP4 (EC 2.7.7.48) (Nonstructural protein 4) (nsP4)] (Fragment) Length = 1148 Score = 29.6 bits (65), Expect = 4.2 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +1 Query: 1 TKPYPTPLPKPSHRRL-PRSAHLRERASGLHLSPSPGRRTSRAQRICS 141 T Y P+P P R+ P A +RAS +SP+P R RA +CS Sbjct: 422 TSEYAKPIPAPRAARVVPVPAPRIQRASTYRVSPTPTPRVLRAS-VCS 468
>CHQB_NOCSI (Q5PXQ6) Hydroxyquinol 1,2-dioxygenase (EC 1.13.11.37) (1,2-HQD)| Length = 293 Score = 29.3 bits (64), Expect = 5.5 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 7 PYPTPLPKPSHRRLPRSAHLRERASGLH-LSPSPGRRT 117 PYP P P R L + RAS LH + +PGRRT Sbjct: 196 PYPIPHDGPVGRMLAATGRSPMRASHLHFMVTAPGRRT 233
>HM23_CAEEL (P34663) Homeobox protein ceh-23| Length = 305 Score = 29.3 bits (64), Expect = 5.5 Identities = 20/44 (45%), Positives = 22/44 (50%) Frame = -2 Query: 433 TAAALDS*RLPTSAFSLSLRDGKLSPTLSLGAASTESNLFPPSR 302 T AAL + PTS S G LSP L A NLFPPS+ Sbjct: 29 TIAALQA--CPTSCIP-STSTGMLSPNLPFSATIPRVNLFPPSQ 69
>PFER_PSEAE (Q04803) Transcriptional activator protein pfeR| Length = 305 Score = 28.9 bits (63), Expect = 7.2 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +1 Query: 13 PTPLPKPSHRRLPRSAH-LRERASGLHLSPSPGR 111 P P PKP RRL R LR R L P PG+ Sbjct: 28 PKPEPKPKQRRLCRKVFPLRARCGALAHCPIPGK 61
>ZN263_HUMAN (O14978) Zinc finger protein 263 (Zinc finger protein FPM315)| Length = 683 Score = 28.5 bits (62), Expect = 9.4 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = +1 Query: 13 PTPLPKPSHRRLPRSAHLRERASGLHLSPSPGRRTSRAQRICSG 144 P P P PS P ++HLR R + P SR Q +C G Sbjct: 29 PPPDPGPS----PEASHLRFRRFRFQEAAGPREALSRLQELCHG 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,503,291 Number of Sequences: 219361 Number of extensions: 740231 Number of successful extensions: 2574 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2568 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)