| Clone Name | bastl03e03 |
|---|---|
| Clone Library Name | barley_pub |
>BGAL_ASPOF (P45582) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 832 Score = 50.1 bits (118), Expect = 2e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +3 Query: 336 TYDRKAVLINGQRRILFSGSIHYPRS 413 TYD K+V+INGQRRIL SGSIHYPRS Sbjct: 28 TYDHKSVIINGQRRILISGSIHYPRS 53
>BGAL_MALDO (P48981) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 731 Score = 48.1 bits (113), Expect = 8e-06 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = +3 Query: 336 TYDRKAVLINGQRRILFSGSIHYPRS 413 +YD KA++INGQ+RIL SGSIHYPRS Sbjct: 27 SYDHKAIIINGQKRILISGSIHYPRS 52
>BGAL_LYCES (P48980) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase) (Acid| beta-galactosidase) (Exo-(1-->4)-beta-D-galactanase) Length = 835 Score = 47.8 bits (112), Expect = 1e-05 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = +3 Query: 336 TYDRKAVLINGQRRILFSGSIHYPRS 413 +YD KA+++NGQR+IL SGSIHYPRS Sbjct: 25 SYDHKAIIVNGQRKILISGSIHYPRS 50
>BGAL_BRAOL (P49676) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| Length = 828 Score = 43.1 bits (100), Expect = 3e-04 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = +3 Query: 336 TYDRKAVLINGQRRILFSGSIHYPRS 413 ++D +A+ I+GQRRIL SGSIHYPRS Sbjct: 28 SHDERAITIDGQRRILLSGSIHYPRS 53
>BGAL_DIACA (Q00662) Putative beta-galactosidase precursor (EC 3.2.1.23)| (Lactase) (SR12 protein) Length = 731 Score = 42.7 bits (99), Expect = 3e-04 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +3 Query: 339 YDRKAVLINGQRRILFSGSIHYPRS 413 YD +A+ IN QRRIL SGSIHYPRS Sbjct: 33 YDYRAIKINDQRRILLSGSIHYPRS 57
>BGAL_ASPNG (P29853) Beta-galactosidase precursor (EC 3.2.1.23) (Lactase)| (Tilactase) (Lactase-N) Length = 1006 Score = 29.6 bits (65), Expect = 2.9 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +3 Query: 336 TYDRKAVLINGQRRILFSGSIH 401 T+D K++ ING+R ++FSG H Sbjct: 47 TWDDKSLFINGERIMIFSGEFH 68
>G7C_MOUSE (Q9JHA8) Protein G7c precursor| Length = 891 Score = 28.5 bits (62), Expect = 6.4 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = -2 Query: 199 DSTRGRAHANAPVPCVVFTGLPPSTPLHHGRTSFSFPVFCWW 74 D G AH+ APV V L PST + GR WW Sbjct: 835 DQLDGPAHSAAPVLPPVSPALLPSTLVTQGRAGGGMAGKAWW 876 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.132 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,024,101 Number of Sequences: 219361 Number of extensions: 717366 Number of successful extensions: 2926 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2922 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)