| Clone Name | bastl02h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PO24_POPJA (Q03275) Retrovirus-related Pol polyprotein from type... | 28 | 6.8 | 2 | FTSK_RHIME (Q92L89) DNA translocase ftsK | 27 | 8.8 | 3 | GAS1_HUMAN (P54826) Growth-arrest-specific protein 1 precursor (... | 27 | 8.8 | 4 | SHAN2_RAT (Q9QX74) SH3 and multiple ankyrin repeat domains prote... | 27 | 8.8 |
|---|
>PO24_POPJA (Q03275) Retrovirus-related Pol polyprotein from type-1| retrotransposable element R2 (Retrovirus-related Pol polyprotein from type I retrotransposable element R2) [Includes: Reverse transcriptase (EC 2.7.7.49); Endonuclease] (Fragment) Length = 482 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 229 VDAFRVRGAVLQGRGVPAGAPGE 297 +DA R+RG +L RG+P+ P E Sbjct: 276 IDAVRLRGNLLPTRGIPSNPPHE 298
>FTSK_RHIME (Q92L89) DNA translocase ftsK| Length = 881 Score = 27.3 bits (59), Expect = 8.8 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +2 Query: 140 ECSELPEPAAAPCRTVSSRHGADDAVGTVVSMLSGYAG-RFSKDAEFRRA 286 E PEPA + RT+ +D G + ++ A R++ A RRA Sbjct: 196 EAEPAPEPAPSKARTIRDELEEEDEEGPLTVLMGSLAHMRYTAQARLRRA 245
>GAS1_HUMAN (P54826) Growth-arrest-specific protein 1 precursor (GAS-1)| Length = 345 Score = 27.3 bits (59), Expect = 8.8 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +2 Query: 140 ECSELPEPAAAPCRTVSSRHGADDAVGTVVSMLSGYAGRFS 262 ECS A C V ++HG DA G + A FS Sbjct: 60 ECSYAYNQYAEACAPVLAQHGGGDAPGAAAAAFPASAASFS 100
>SHAN2_RAT (Q9QX74) SH3 and multiple ankyrin repeat domains protein 2 (Shank2)| (Proline-rich synapse-associated protein 1) (ProSAP1) (Cortactin-binding protein 1) (CortBP1) (GKAP/SAPAP-interacting protein) (SPANK-3) Length = 1474 Score = 27.3 bits (59), Expect = 8.8 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 140 ECSELPEPAAAPCRTVSSRHGADDAV 217 + S PEPAAAP RT+ + ++AV Sbjct: 985 QISAAPEPAAAPGRTIVAAGSVEEAV 1010 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,270,524 Number of Sequences: 219361 Number of extensions: 357501 Number of successful extensions: 1310 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1285 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1310 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)