| Clone Name | bastl02g12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HGL2_ARATH (P46607) Homeobox protein GLABRA2 (Homeobox-leucine z... | 33 | 0.41 |
|---|
>HGL2_ARATH (P46607) Homeobox protein GLABRA2 (Homeobox-leucine zipper protein| ATHB-10) (HD-ZIP protein ATHB-10) Length = 745 Score = 32.7 bits (73), Expect = 0.41 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +2 Query: 338 KYVRYTPEQVDALERVYSECPKPSSLRRQQLIRE 439 KY R+T +Q+ +E ++ E P P +RQQL ++ Sbjct: 102 KYHRHTTDQIRHMEALFKETPHPDEKQRQQLSKQ 135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,579,798 Number of Sequences: 219361 Number of extensions: 344810 Number of successful extensions: 1221 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1221 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)