| Clone Name | bastl02a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | B3A3_MOUSE (P16283) Anion exchange protein 3 (Neuronal band 3-li... | 32 | 0.90 | 2 | CDAN1_HUMAN (Q8IWY9) Codanin-1 | 31 | 1.5 | 3 | BRD4_HUMAN (O60885) Bromodomain-containing protein 4 (HUNK1 prot... | 30 | 2.6 | 4 | Y369_TREPA (O83384) Hypothetical protein TP0369 precursor | 30 | 2.6 | 5 | ALMS1_HUMAN (Q8TCU4) Alstrom syndrome protein 1 | 29 | 5.8 | 6 | LRP2_RAT (P98158) Low-density lipoprotein receptor-related prote... | 29 | 5.8 | 7 | J1L_HCMVA (P17143) Hypothetical protein J1L | 29 | 5.8 |
|---|
>B3A3_MOUSE (P16283) Anion exchange protein 3 (Neuronal band 3-like protein)| (Solute carrier family 4 member 3) Length = 1227 Score = 32.0 bits (71), Expect = 0.90 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = +3 Query: 33 PHRLRPPPHNSISQSRRRYKKPRA---PERGWPP 125 PH+LR PP S +RR+ KK + P G PP Sbjct: 92 PHKLRRPPPTSARHTRRKRKKEKTSAPPSEGTPP 125
>CDAN1_HUMAN (Q8IWY9) Codanin-1| Length = 1226 Score = 31.2 bits (69), Expect = 1.5 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 8/62 (12%) Frame = +3 Query: 48 PPPHNSISQSRRRYKKPRAPERG--------WPPNKAANRAAESRVLESGGRL*NPNPLR 203 P P + S +P P RG +PP +A + AAE+ + GGR P P R Sbjct: 70 PTPAKTPGASAALPGRPGGPPRGSRGARSQLFPPTEAQSTAAEAPLARRGGRRRGPGPAR 129 Query: 204 IR 209 R Sbjct: 130 ER 131
>BRD4_HUMAN (O60885) Bromodomain-containing protein 4 (HUNK1 protein)| Length = 1362 Score = 30.4 bits (67), Expect = 2.6 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 6 PTPRTNAGHPHRLRPPPHNSISQSRRRYKKPRAPERGWPP 125 P+ + + P L PPPH S+ Q ++ P P + PP Sbjct: 946 PSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPP 985
>Y369_TREPA (O83384) Hypothetical protein TP0369 precursor| Length = 516 Score = 30.4 bits (67), Expect = 2.6 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 12 PRTNAGHPHRLRPPPHN-SISQSRRRYKKPRAPERGWPPNKAANRA 146 P A PHR PPP + S S+ ++R P P PP +A +A Sbjct: 128 PAPTAPRPHRPSPPPVSPSASKPKQRAVPPSPPPASEPPREAEVQA 173
>ALMS1_HUMAN (Q8TCU4) Alstrom syndrome protein 1| Length = 4167 Score = 29.3 bits (64), Expect = 5.8 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +3 Query: 27 GHPHRLRPPPHNSISQSRRRYKKPRAPERGWPPNK 131 G P P +I+Q ++K PE WP NK Sbjct: 3418 GDPEMKNLPDTKAITQKEEIHRKKTVPEEAWPNNK 3452
>LRP2_RAT (P98158) Low-density lipoprotein receptor-related protein 2 precursor| (Megalin) (Glycoprotein 330) (gp330) Length = 4660 Score = 29.3 bits (64), Expect = 5.8 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 13 PAPTPAIPTASGRRRTTPSPKAEEDT 90 P P+P++P + +R TP A EDT Sbjct: 4621 PPPSPSLPAKASKRNLTPGYTATEDT 4646
>J1L_HCMVA (P17143) Hypothetical protein J1L| Length = 309 Score = 29.3 bits (64), Expect = 5.8 Identities = 18/67 (26%), Positives = 27/67 (40%), Gaps = 9/67 (13%) Frame = +3 Query: 3 CPTPRTNAGHPHRLRPPPHNSISQSRRRYKKP---------RAPERGWPPNKAANRAAES 155 CP P+ N + R P P S + + P R PER P+K + ++ Sbjct: 13 CPRPQRNLPYAARTAPAPAQPPSPAPTPSRTPPVSATPRHRRRPERSKTPDKRSAETTQA 72 Query: 156 RVLESGG 176 R +E G Sbjct: 73 RTVERTG 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.309 0.129 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,469,250 Number of Sequences: 219361 Number of extensions: 850491 Number of successful extensions: 2521 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2512 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)