| Clone Name | bastl01h10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RIC1_YEAST (P40395) Protein RIC1 | 37 | 0.012 | 2 | ACCN3_HUMAN (Q9UHC3) Amiloride-sensitive cation channel 3 (Acid-... | 29 | 3.4 | 3 | YTUB_ENTAG (Q47826) Hypothetical protein in tutB 3'region (Fragm... | 28 | 5.8 | 4 | NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 pr... | 28 | 7.5 | 5 | ACCN3_MOUSE (Q6X1Y6) Amiloride-sensitive cation channel 3 (Acid-... | 27 | 9.8 |
|---|
>RIC1_YEAST (P40395) Protein RIC1| Length = 1056 Score = 37.0 bits (84), Expect = 0.012 Identities = 14/33 (42%), Positives = 22/33 (66%), Gaps = 3/33 (9%) Frame = -3 Query: 93 YLIMARKKKVLCF---VSYFSDSWKPPLCVRLC 4 YL++ K+K++CF + S SWKPP ++LC Sbjct: 366 YLVVVYKEKIICFDTRIKKVSHSWKPPFVIKLC 398
>ACCN3_HUMAN (Q9UHC3) Amiloride-sensitive cation channel 3 (Acid-sensing ion| channel 3) (ASIC3) (hASIC3) (Testis sodium channel 1) (hTNaC1) Length = 531 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -2 Query: 295 HLSLPRRPHTPPAAVTK 245 HLSL RP TPP AVTK Sbjct: 500 HLSLGPRPPTPPCAVTK 516
>YTUB_ENTAG (Q47826) Hypothetical protein in tutB 3'region (Fragment)| Length = 204 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 319 RDHPPVGRHLSLPRRPHTPPAAVTKA 242 RDHP + L+ P +PH+ P + +A Sbjct: 140 RDHPLIVADLAQPHQPHSAPGIIVEA 165
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 27.7 bits (60), Expect = 7.5 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 322 PRDHPPVGRHLSLPRRPHTP 263 P+ PP G+H++ PR P P Sbjct: 2284 PQSRPPEGKHITTPREPLPP 2303
>ACCN3_MOUSE (Q6X1Y6) Amiloride-sensitive cation channel 3 (Acid-sensing ion| channel 3) (ASIC3) (Dorsal root ASIC) (DRASIC) Length = 530 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -2 Query: 319 RDHPPVGRHLSLPRRPHTPPAAVTK 245 R H P HLSL RP T P+AVTK Sbjct: 494 RTHVP---HLSLGPRPPTAPSAVTK 515 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,628,787 Number of Sequences: 219361 Number of extensions: 473700 Number of successful extensions: 1261 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1260 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)