| Clone Name | bastl01g05 |
|---|---|
| Clone Library Name | barley_pub |
>CRY2_ARATH (Q96524) Cryptochrome-2 (Blue light photoreceptor)| Length = 612 Score = 31.6 bits (70), Expect = 0.83 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = +3 Query: 387 RTVVWFRRDLRVED 428 +T+VWFRRDLR+ED Sbjct: 6 KTIVWFRRDLRIED 19
>PHR1_SINAL (P40115) Deoxyribodipyrimidine photo-lyase (EC 4.1.99.3) (DNA| photolyase) (Photoreactivating enzyme) Length = 501 Score = 31.6 bits (70), Expect = 0.83 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = +3 Query: 387 RTVVWFRRDLRVED 428 +T+VWFRRDLR+ED Sbjct: 6 KTIVWFRRDLRIED 19
>PEPB_STRA5 (Q8E0C9) Group B oligopeptidase pepB (EC 3.4.24.-)| Length = 601 Score = 30.0 bits (66), Expect = 2.4 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +3 Query: 6 HHHPTSQQKILQKSFLYEKEGEILVRFTPHHFP 104 HH+ +++Q L +F+ E+ E L++ HH P Sbjct: 247 HHYQSARQSALSANFIPEEVYETLIKTVNHHLP 279
>PEPB_STRA3 (Q53778) Group B oligopeptidase pepB (EC 3.4.24.-)| Length = 601 Score = 30.0 bits (66), Expect = 2.4 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +3 Query: 6 HHHPTSQQKILQKSFLYEKEGEILVRFTPHHFP 104 HH+ +++Q L +F+ E+ E L++ HH P Sbjct: 247 HHYQSARQSALSANFIPEEVYETLIKTVNHHLP 279
>MURC_LACJO (P61680) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 437 Score = 29.6 bits (65), Expect = 3.2 Identities = 18/58 (31%), Positives = 28/58 (48%) Frame = +3 Query: 9 HHPTSQQKILQKSFLYEKEGEILVRFTPHHFPCTGTEETVPAQFIPRFQEILADPGKS 182 HHPT + +Q + + E++V F PH F T ++ F+EIL D K+ Sbjct: 321 HHPTEMRATIQAARQKFPDKELVVVFQPHTFSRT-------KKYQKDFEEILRDVDKA 371
>CRY1_ARATH (Q43125) Cryptochrome-1 (Blue light photoreceptor)| Length = 681 Score = 29.6 bits (65), Expect = 3.2 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +3 Query: 390 TVVWFRRDLRVED 428 ++VWFRRDLRVED Sbjct: 14 SIVWFRRDLRVED 26
>RNPH_RHIME (Q92SK2) Ribonuclease PH (EC 2.7.7.56) (RNase PH) (tRNA| nucleotidyltransferase) Length = 239 Score = 29.3 bits (64), Expect = 4.1 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 39 QKSFLYEKEGEILVRFTPHHFPCTGT-EETVPA 134 ++SF EG LVRF H CT + EE VPA Sbjct: 17 ERSFSKHAEGSCLVRFGDTHVLCTASLEEKVPA 49
>Y403_RALSO (Q8Y2D3) UPF0042 protein RSc0403| Length = 296 Score = 28.9 bits (63), Expect = 5.4 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 4/59 (6%) Frame = +3 Query: 120 ETVPAQFIPRFQEILADPGKSC*ATHTGAPTKFAS*Q----LPELLLLVIQERQGNELF 284 + +PAQFIP LAD G TH G T S + +PE + + +E LF Sbjct: 30 DNLPAQFIPELARYLADQG----YTHLGVATDIRSRESLRKVPETITQLRKEHDVRMLF 84
>TRPH_SALTY (O54453) Protein trpH| Length = 293 Score = 28.9 bits (63), Expect = 5.4 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = -2 Query: 254 NEQQQLRELS*SKLCWRSGVGSSTRFAWIGEDFLEP--WNELGRNGFLSAGAWEMMWSKS 81 NE+ QL L+ W S +G DF +P W ELGR +L AG E +W Sbjct: 238 NERTQLATLARQHHLWAS----------LGSDFHQPCPWIELGRKLWLPAGV-EGVWQTW 286 Query: 80 DQ 75 +Q Sbjct: 287 EQ 288
>MNTH_MYCBO (O69443) Probable manganese transport protein mntH (BRAMP)| Length = 684 Score = 28.9 bits (63), Expect = 5.4 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +3 Query: 240 LLLLVIQERQGNELFPWVIS*LLVV 314 LLLL IQ+R+G LF VI+ LL+V Sbjct: 410 LLLLTIQDRRGQRLFERVITALLLV 434
>MNTH_MYCTU (O05916) Probable manganese transport protein mntH| Length = 428 Score = 28.9 bits (63), Expect = 5.4 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = +3 Query: 240 LLLLVIQERQGNELFPWVIS*LLVV 314 LLLL IQ+R+G LF VI+ LL+V Sbjct: 154 LLLLTIQDRRGQRLFERVITALLLV 178
>MURC_LACAC (Q5FIS8) UDP-N-acetylmuramate--L-alanine ligase (EC 6.3.2.8)| (UDP-N-acetylmuramoyl-L-alanine synthetase) Length = 437 Score = 28.1 bits (61), Expect = 9.2 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +3 Query: 9 HHPTSQQKILQKSFLYEKEGEILVRFTPHHFPCTGTEETVPAQFIPRFQEILADPGKS 182 HHPT + +Q + + +++V F PH F T ++ F+EIL D K+ Sbjct: 321 HHPTEMRATIQAARQKFPDKKLVVVFQPHTFSRT-------KKYQKDFEEILRDVDKA 371
>EBSC_ENTFA (P36922) Protein ebsC| Length = 164 Score = 28.1 bits (61), Expect = 9.2 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +2 Query: 17 HLPAKNTPEIFFVRKRRGNIGQIYSTSFPMHRH*GNRSGPVHSTVPGN 160 HL A++ E + K G+I+ T + GN++GPV + +PGN Sbjct: 34 HLSAESVAESLGIEK-----GRIFKTLVTV----GNKTGPVVAVIPGN 72 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,458,175 Number of Sequences: 219361 Number of extensions: 1368187 Number of successful extensions: 4275 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 4151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4274 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)