| Clone Name | bast79h09 |
|---|---|
| Clone Library Name | barley_pub |
>FOXC2_HUMAN (Q99958) Forkhead box protein C2 (Forkhead-related protein FKHL14)| (Mesenchyme fork head protein 1) (MFH-1 protein) (Transcription factor FKH-14) Length = 501 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = -3 Query: 215 HHHRRHGEQAEAAAPSPPLHGPGPGAQP 132 HHH+ HG A P PP P P QP Sbjct: 387 HHHQHHGHHHPQAPPPPPAPQPQPTPQP 414
>METRN_HUMAN (Q9UJH8) Meteorin precursor| Length = 293 Score = 29.6 bits (65), Expect = 2.2 Identities = 22/59 (37%), Positives = 27/59 (45%) Frame = -3 Query: 194 EQAEAAAPSPPLHGPGPGAQPLKMRCFRVRVGIEFWLPVGRRQL*LQASPHWSLSLQVS 18 E+A A GPGP RC R W P RR L LQA+PH +S +V+ Sbjct: 97 ERAGGALELLLAEGPGPAGG----RCVR-------WGPRERRALFLQATPHQDISRRVA 144
>RS3_RHOS4 (Q3J5R6) 30S ribosomal protein S3| Length = 238 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -3 Query: 218 QHHHRRHGEQAEAAAPSPP 162 Q H RRH E E AAP PP Sbjct: 213 QAHDRRHSEAQEGAAPRPP 231
>TNKS1_HUMAN (O95271) Tankyrase 1 (EC 2.4.2.30) (TANK1) (Tankyrase I) (TNKS-1)| (TRF1-interacting ankyrin-related ADP-ribose polymerase) Length = 1327 Score = 28.9 bits (63), Expect = 3.8 Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 5/34 (14%) Frame = -3 Query: 218 QHHHRRHGEQAE----AAAPSPPLHGP-GPGAQP 132 QHHH H +Q + A+AP PP P PG P Sbjct: 8 QHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAP 41
>YAGY_ECOLI (P77188) Hypothetical protein yagY precursor| Length = 222 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 29 ARVTSEARLVAIAAFSPREAKIRFQHARGS 118 A T+ AR+ I +PR+A FQ+A GS Sbjct: 129 AVATASARIGTILVVAPRQANYHFQYANGS 158
>DMWD_MOUSE (Q08274) Dystrophia myotonica WD repeat-containing protein| (Dystrophia myotonica-containing WD repeat motif protein) (DMR-N9 protein) Length = 650 Score = 28.1 bits (61), Expect = 6.5 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 Query: 197 GEQAEAAAPSPPLHGPGPGAQPLKMRCFRVRVG 99 G A A SPP GPGPG +R VR+G Sbjct: 54 GPGAAGPASSPPPAGPGPGPALPAVRLSLVRLG 86
>BRD4_HUMAN (O60885) Bromodomain-containing protein 4 (HUNK1 protein)| Length = 1362 Score = 28.1 bits (61), Expect = 6.5 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -3 Query: 218 QHHHRRHGEQAEAAAPSPPLHGPGPGAQP 132 +HHH H + +A AP P P P P Sbjct: 737 KHHHHHHQQMQQAPAPVPQQPPPPPQQPP 765
>MA2B2_PIG (Q28949) Epididymis-specific alpha-mannosidase precursor (EC| 3.2.1.24) (Mannosidase alpha class 2B member 2) (AMAN) Length = 995 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 215 HHHRRHGEQAEAAAPSPPLHGPGPGAQPLKMRCF 114 HHHR + P PPL GP P ++R F Sbjct: 960 HHHR-----GSSRRPLPPLRGPNVTIHPKEIRTF 988 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,917,973 Number of Sequences: 219361 Number of extensions: 429605 Number of successful extensions: 2332 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2092 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2299 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)