| Clone Name | bast79h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ILV5_PEA (O82043) Ketol-acid reductoisomerase, chloroplast precu... | 104 | 9e-23 | 2 | ILV5_SPIOL (Q01292) Ketol-acid reductoisomerase, chloroplast pre... | 103 | 1e-22 | 3 | ILV5_ARATH (Q05758) Ketol-acid reductoisomerase, chloroplast pre... | 102 | 4e-22 |
|---|
>ILV5_PEA (O82043) Ketol-acid reductoisomerase, chloroplast precursor (EC| 1.1.1.86) (Acetohydroxy-acid reductoisomerase) (Alpha-keto-beta-hydroxylacil reductoisomerase) Length = 581 Score = 104 bits (260), Expect = 9e-23 Identities = 48/57 (84%), Positives = 55/57 (96%) Frame = +2 Query: 278 SLDFDTAVFNKEKVSLAGHEEYIVRGGRNLFPLLPEAFKGVKQIGVIGWGSQGPAQA 448 SLDF+T+VF KE+V+LAGHEEYIVRGGR+LF LLP+AFKG+KQIGVIGWGSQGPAQA Sbjct: 69 SLDFETSVFKKERVNLAGHEEYIVRGGRDLFHLLPDAFKGIKQIGVIGWGSQGPAQA 125
>ILV5_SPIOL (Q01292) Ketol-acid reductoisomerase, chloroplast precursor (EC| 1.1.1.86) (Acetohydroxy-acid reductoisomerase) (Alpha-keto-beta-hydroxylacil reductoisomerase) Length = 595 Score = 103 bits (258), Expect = 1e-22 Identities = 46/57 (80%), Positives = 54/57 (94%) Frame = +2 Query: 278 SLDFDTAVFNKEKVSLAGHEEYIVRGGRNLFPLLPEAFKGVKQIGVIGWGSQGPAQA 448 + DFD++VF KEKV+L+GH+EYIVRGGRNLFPLLP+AFKG+KQIGVIGWGSQ PAQA Sbjct: 85 TFDFDSSVFKKEKVTLSGHDEYIVRGGRNLFPLLPDAFKGIKQIGVIGWGSQAPAQA 141
>ILV5_ARATH (Q05758) Ketol-acid reductoisomerase, chloroplast precursor (EC| 1.1.1.86) (Acetohydroxy-acid reductoisomerase) (Alpha-keto-beta-hydroxylacil reductoisomerase) Length = 591 Score = 102 bits (254), Expect = 4e-22 Identities = 48/57 (84%), Positives = 54/57 (94%) Frame = +2 Query: 278 SLDFDTAVFNKEKVSLAGHEEYIVRGGRNLFPLLPEAFKGVKQIGVIGWGSQGPAQA 448 SLDF+T+VF KEKVSLAG+EEYIVRGGR+LF LP+AFKG+KQIGVIGWGSQGPAQA Sbjct: 79 SLDFETSVFKKEKVSLAGYEEYIVRGGRDLFKHLPDAFKGIKQIGVIGWGSQGPAQA 135 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.140 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,920,890 Number of Sequences: 219361 Number of extensions: 359643 Number of successful extensions: 1219 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1219 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)