| Clone Name | bast79g11 |
|---|---|
| Clone Library Name | barley_pub |
>SGS3_DROME (P02840) Salivary glue protein Sgs-3 precursor| Length = 307 Score = 34.7 bits (78), Expect = 0.094 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +3 Query: 21 QLQLKAPSTTPLT--QTASQAKCVTPTSSRPASLRSTAAR-SCSRPAT 155 Q + P TTP T QT +Q C TPT+++P + + T + + ++P T Sbjct: 118 QTTTQLPCTTPTTTKQTTTQLPCTTPTTTKPTTTKPTTTKPTTTKPTT 165 Score = 30.0 bits (66), Expect = 2.3 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +3 Query: 6 SPHISQLQLKAPSTT--PLT--QTASQAKCVTPTSSRPASLRSTAARSCSRPAT 155 +P Q + P TT P T QT +Q C TPT+++ + + T ++ + AT Sbjct: 56 APPTQQSTTQPPCTTSKPTTPKQTTTQLPCTTPTTTKATTTKPTTTKATTTKAT 109 Score = 29.3 bits (64), Expect = 3.9 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +3 Query: 33 KAPSTTPLT--QTASQAKCVTPTSSRPASLRSTAARSCSRPAT 155 KA +T P T QT +Q C TPT+++ ++T C+ P T Sbjct: 107 KATTTKPTTTKQTTTQLPCTTPTTTK----QTTTQLPCTTPTT 145
>SDC_DROME (P49415) Syndecan precursor| Length = 399 Score = 29.3 bits (64), Expect = 3.9 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 42 STTPLTQTASQAKCVTPTSSRPASLRSTAARSCS 143 ST P T T++ TPT++ PAS + AA S Sbjct: 123 STIPTTSTSTPMPTTTPTATTPASTTTAAATQIS 156
>GYRB_MYXXA (O33367) DNA gyrase subunit B (EC 5.99.1.3)| Length = 815 Score = 28.9 bits (63), Expect = 5.2 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 33 KAPSTTPLTQTASQAKCVTPTSSRPASLRSTAARSCSRPAT 155 + PSTTP ++ C TPT P R + SC R +T Sbjct: 664 RTPSTTP------RSWCSTPTRMEPCGRRCSTTPSCRRRST 698
>UBQL2_MOUSE (Q9QZM0) Ubiquilin-2 (Protein linking IAP with cytoskeleton 2)| (PLIC-2) (Ubiquitin-like product Chap1/Dsk2) (DSK2 homolog) (Chap1) Length = 638 Score = 28.9 bits (63), Expect = 5.2 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +3 Query: 39 PSTTPLTQTASQAKCVTPTSSRPASLRSTAARSCSRPAT 155 PSTT T T + T T++ PA+ S+A RS S P T Sbjct: 116 PSTTAGTSTTTTT---TTTAAAPAATTSSAPRSSSTPTT 151
>GAB1_MOUSE (Q9QYY0) GRB2-associated-binding protein 1 (GRB2-associated binder| 1) Length = 695 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +3 Query: 27 QLKAPSTTPLTQTASQAKCVTPTSSRPASLRSTAARSCS 143 +L+AP +P+T++ ++ P S RP S+ ST + S S Sbjct: 545 ELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDS 583
>GAB1_MESAU (Q99PF6) GRB2-associated-binding protein 1 (GRB2-associated binder| 1) Length = 694 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +3 Query: 27 QLKAPSTTPLTQTASQAKCVTPTSSRPASLRSTAARSCS 143 +L+AP +P+T++ ++ P S RP S+ ST + S S Sbjct: 544 ELQAPVRSPITRSFARDSSRFPLSPRPNSVHSTTSSSDS 582
>GAB1_HUMAN (Q13480) GRB2-associated-binding protein 1 (GRB2-associated binder| 1) Length = 694 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +3 Query: 27 QLKAPSTTPLTQTASQAKCVTPTSSRPASLRSTAARSCS 143 +L+AP +P+T++ ++ P S RP S+ ST + S S Sbjct: 544 ELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDS 582
>TSH1_HUMAN (Q6ZSZ6) Teashirt homolog 1 (Serologically defined colon cancer| antigen 3) (Antigen NY-CO-33) Length = 1077 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = +3 Query: 24 LQLKAPSTTPLTQTASQAKCVTPTSSRPASLRSTAARSCSRPATA 158 L LK +T T ASQ + PT + P ST + S P+T+ Sbjct: 134 LDLKKSGSTTSTNDASQKESSAPTPTPPTCPVSTTGPTTSTPSTS 178
>YS89_CAEEL (Q09624) Hypothetical protein ZK945.9| Length = 3178 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +3 Query: 36 APSTTPLTQTASQAKCVTPTSSRPASLRSTAARSCSRPATA 158 +PST+P+T T + + + T + P S ST+ S T+ Sbjct: 452 SPSTSPVTSTVTSSSSSSTTVTTPTSTESTSTSPSSTVTTS 492
>BTD_DROME (Q24266) Transcription factor btd (Protein buttonhead)| Length = 644 Score = 28.1 bits (61), Expect = 8.8 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 2/42 (4%) Frame = +3 Query: 39 PSTT--PLTQTASQAKCVTPTSSRPASLRSTAARSCSRPATA 158 P+TT P T A+ A +PTSS P+S ++AA + + A A Sbjct: 177 PTTTLAPPTTAAAGALAGSPTSSSPSSSAASAAAAAAAAAAA 218 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,416,443 Number of Sequences: 219361 Number of extensions: 506361 Number of successful extensions: 2418 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2408 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)