| Clone Name | bast79g10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YGER_ECOLI (Q46798) Hypothetical lipoprotein ygeR precursor | 31 | 1.4 |
|---|
>YGER_ECOLI (Q46798) Hypothetical lipoprotein ygeR precursor| Length = 251 Score = 31.2 bits (69), Expect = 1.4 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -2 Query: 141 TTARASPCP*SRCPTWSWSCLRRRAWTWPPT 49 TT AS P S P SW + +R W WP T Sbjct: 101 TTKTASVTPSSAVPKSSWPPVGQRCWLWPTT 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.132 0.488 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,521,114 Number of Sequences: 219361 Number of extensions: 409742 Number of successful extensions: 1514 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1513 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)