| Clone Name | bast79g04 |
|---|---|
| Clone Library Name | barley_pub |
>VIV_ORYSA (P37398) Protein viviparous homolog| Length = 728 Score = 30.8 bits (68), Expect = 2.0 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 397 EESGDPCMDGKDLIAPSDLPPFYAQ 471 +++GD CM+G D AP DLP F+ + Sbjct: 169 DDAGDACMEGSD--APDDLPAFFME 191
>UFO3_MAIZE (P16167) Anthocyanidin 3-O-glucosyltransferase (EC 2.4.1.115)| (Flavonol 3-O-glucosyltransferase) (UDP-glucose flavonoid 3-O-glucosyltransferase) (Bronze-1) (Bz-W22 allele) Length = 471 Score = 30.4 bits (67), Expect = 2.6 Identities = 18/39 (46%), Positives = 21/39 (53%) Frame = -2 Query: 371 CPRPDDRARTRSISPGRGAPSDAPFFLLLRRDQAALAPP 255 CPRPD+ R ++ G A S APF LR D L PP Sbjct: 300 CPRPDE---LRELAAGLEA-SGAPFLWSLREDSWTLLPP 334
>ACHB2_HUMAN (P17787) Neuronal acetylcholine receptor protein, beta-2 subunit| precursor Length = 502 Score = 30.4 bits (67), Expect = 2.6 Identities = 20/54 (37%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +3 Query: 234 PRHPFFLRRCQRRLVTPEEEEEGSIAWRSSAGADRPCSCTIIRARAVGF-HAFG 392 PRH +R + R E E G++ +R + GAD C+C + RA G AFG Sbjct: 352 PRHHCARQRLRLRRRQREREGAGALFFREAPGAD-SCTCFVNRASVQGLAGAFG 404
>UFO2_MAIZE (P16165) Anthocyanidin 3-O-glucosyltransferase (EC 2.4.1.115)| (Flavonol 3-O-glucosyltransferase) (UDP-glucose flavonoid 3-O-glucosyltransferase) (Bronze-1) (Bz-Mc2 allele) Length = 471 Score = 30.0 bits (66), Expect = 3.4 Identities = 18/39 (46%), Positives = 21/39 (53%) Frame = -2 Query: 371 CPRPDDRARTRSISPGRGAPSDAPFFLLLRRDQAALAPP 255 CPRPD+ R ++ G A S APF LR D L PP Sbjct: 300 CPRPDE---LRELAAGLEA-SAAPFLWSLREDSWTLLPP 334
>JHD3A_PONPY (Q5RD88) JmjC domain-containing histone demethylation protein 3A| (EC 1.14.11.-) (Jumonji domain-containing protein 2A) Length = 1064 Score = 28.9 bits (63), Expect = 7.6 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +3 Query: 222 SHLPPRHPFFLRRC-----QRRLVTPEEEEEGSIAW 314 S LP HP L+ C +TPEEE E + AW Sbjct: 601 SKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAW 636
>JHD3A_MOUSE (Q8BW72) JmjC domain-containing histone demethylation protein 3A| (EC 1.14.11.-) (Jumonji domain-containing protein 2A) Length = 1064 Score = 28.9 bits (63), Expect = 7.6 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +3 Query: 222 SHLPPRHPFFLRRC-----QRRLVTPEEEEEGSIAW 314 S LP HP L+ C +TPEEE E + AW Sbjct: 601 SKLPRHHPLVLQECGSDDETSEQLTPEEEAEETEAW 636
>JHD3A_HUMAN (O75164) JmjC domain-containing histone demethylation protein 3A| (EC 1.14.11.-) (Jumonji domain-containing protein 2A) Length = 1064 Score = 28.9 bits (63), Expect = 7.6 Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Frame = +3 Query: 222 SHLPPRHPFFLRRC-----QRRLVTPEEEEEGSIAW 314 S LP HP L+ C +TPEEE E + AW Sbjct: 601 SKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAW 636 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,012,731 Number of Sequences: 219361 Number of extensions: 884072 Number of successful extensions: 2169 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2168 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)