| Clone Name | bast79g01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SPB4_EMENI (Q5B8F4) ATP-dependent rRNA helicase spb4 (EC 3.6.1.-) | 30 | 4.2 | 2 | SPB4_ASPOR (Q2UBZ5) ATP-dependent rRNA helicase spb4 (EC 3.6.1.-) | 30 | 4.2 | 3 | YCF2_OENHO (Q9MEF2) Protein ycf2 | 29 | 5.5 | 4 | ABRA_PLAFC (P22620) 101 kDa malaria antigen (p101) (Acidic basic... | 28 | 9.4 |
|---|
>SPB4_EMENI (Q5B8F4) ATP-dependent rRNA helicase spb4 (EC 3.6.1.-)| Length = 638 Score = 29.6 bits (65), Expect = 4.2 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 23 NKGEKGRERETEVKRGEKKKWSLQTEEKIKR 115 N+ +K + R+ + R E+K+W TEE+ K+ Sbjct: 564 NRNKKAKRRDMKQVRQERKRWEKMTEEEKKK 594
>SPB4_ASPOR (Q2UBZ5) ATP-dependent rRNA helicase spb4 (EC 3.6.1.-)| Length = 638 Score = 29.6 bits (65), Expect = 4.2 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +2 Query: 23 NKGEKGRERETEVKRGEKKKWSLQTEEKIKRDRAMQHEI 139 ++ +K + RE + +R EK KW TEE+ ++ R + + Sbjct: 565 DRNKKQKRREQKQRRQEKNKWEKMTEEERQKIRETEQMV 603
>YCF2_OENHO (Q9MEF2) Protein ycf2| Length = 2280 Score = 29.3 bits (64), Expect = 5.5 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 2/45 (4%) Frame = +2 Query: 8 EKYCINKGEKGRERETEVKRGEKKK--WSLQTEEKIKRDRAMQHE 136 EK K EK +E++ E KR EKK+ + Q EK++ DRA+Q E Sbjct: 1170 EKRKEKKPEKRKEKKPE-KRKEKKQSLYLKQLVEKVQMDRALQGE 1213
>ABRA_PLAFC (P22620) 101 kDa malaria antigen (p101) (Acidic basic repeat| antigen) Length = 743 Score = 28.5 bits (62), Expect = 9.4 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 23 NKGEKGRERETEVKRGEKKKWSLQTEEKIKRDRAMQHE 136 NK E+ +E+E E ++ EK+K + EEK K + E Sbjct: 673 NKEEEEKEKEKEKEKEEKEKEEKEKEEKEKEKEEKEKE 710 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,811,307 Number of Sequences: 219361 Number of extensions: 292324 Number of successful extensions: 1162 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1145 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)