ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast79e05 |
|---|---|
| Clone Library Name | barley_pub |
>OTUBL_ARATH (Q8LG98) Ubiquitin thioesterase otubain-like protein (EC 3.4.-.-)| (Ubiquitin-specific-processing protease otubain-like) (Deubiquitinating enzyme otubain-like) Length = 306 Score = 124 bits (312), Expect = 1e-28 Identities = 58/73 (79%), Positives = 68/73 (93%) Frame = +3 Query: 249 QVPYIGNKEPLSALAAEFQSGSPILQEKIKLLGEQYDALRRTRGDGNCFYRSFMFSYLEH 428 +VPY+G+KEPLS+LAAE+QSGSPIL EKIK+L QY +RRTRGDGNCF+RSFMFSYLEH Sbjct: 45 KVPYVGDKEPLSSLAAEYQSGSPILLEKIKILDSQYIGIRRTRGDGNCFFRSFMFSYLEH 104 Query: 429 ILETQDRAEVERI 467 ILE+QDRAEV+RI Sbjct: 105 ILESQDRAEVDRI 117
>OTUB1_MOUSE (Q7TQI3) Ubiquitin thioesterase protein OTUB1 (EC 3.4.-.-) (Otubain| 1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Ubiquitin-specific-processing protease OTUB1) (Deubiquitinating enzyme OTUB1) Length = 271 Score = 61.6 bits (148), Expect = 1e-09 Identities = 32/72 (44%), Positives = 46/72 (63%) Frame = +3 Query: 249 QVPYIGNKEPLSALAAEFQSGSPILQEKIKLLGEQYDALRRTRGDGNCFYRSFMFSYLEH 428 Q P + + LS L E+ I Q+KIK L ++Y +R+TR DGNCFYR+F FS+LE Sbjct: 44 QNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEA 103 Query: 429 ILETQDRAEVER 464 +L+ D E++R Sbjct: 104 LLD--DSKELQR 113
>OTUB1_HUMAN (Q96FW1) Ubiquitin thioesterase protein OTUB1 (EC 3.4.-.-) (Otubain| 1) (OTU domain-containing ubiquitin aldehyde-binding protein 1) (Ubiquitin-specific-processing protease OTUB1) (Deubiquitinating enzyme OTUB1) Length = 271 Score = 61.6 bits (148), Expect = 1e-09 Identities = 32/72 (44%), Positives = 46/72 (63%) Frame = +3 Query: 249 QVPYIGNKEPLSALAAEFQSGSPILQEKIKLLGEQYDALRRTRGDGNCFYRSFMFSYLEH 428 Q P + + LS L E+ I Q+KIK L ++Y +R+TR DGNCFYR+F FS+LE Sbjct: 44 QNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEA 103 Query: 429 ILETQDRAEVER 464 +L+ D E++R Sbjct: 104 LLD--DSKELQR 113
>OTUBL_DROME (Q9VL00) Ubiquitin thioesterase otubain-like protein (EC 3.4.-.-)| (Ubiquitin-specific-processing protease otubain-like) (Deubiquitinating enzyme otubain-like) Length = 262 Score = 60.1 bits (144), Expect = 3e-09 Identities = 28/60 (46%), Positives = 42/60 (70%) Frame = +3 Query: 255 PYIGNKEPLSALAAEFQSGSPILQEKIKLLGEQYDALRRTRGDGNCFYRSFMFSYLEHIL 434 P + + PL+ L AE+ SG I KI+ L ++Y +RRTR DGNCF+R+F +SYLE+++ Sbjct: 31 PLVSEQLPLTCLYAEY-SGDEIFTAKIQDLSKKYKFIRRTRPDGNCFFRAFAYSYLEYLI 89
>OTUB2_MOUSE (Q9CQX0) Ubiquitin thioesterase protein OTUB2 (EC 3.4.-.-) (Otubain| 2) (OTU domain-containing ubiquitin aldehyde-binding protein 2) (Ubiquitin-specific-processing protease OTUB2) (Deubiquitinating enzyme OTUB2) Length = 234 Score = 50.8 bits (120), Expect = 2e-06 Identities = 25/57 (43%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = +3 Query: 318 ILQEKIKLLGEQYDALRRTRGDGNCFYRSFMFSYLEHIL--ETQDRAEVERILKTLN 482 I Q KI+ L +++ ++R+T+GDGNCFYR+ +SYLE +L + ER+L+T N Sbjct: 27 IYQRKIQELSKRFTSIRKTKGDGNCFYRALGYSYLESLLGKSREILKFKERVLQTPN 83
>OTUBL_CAEEL (Q9XVR6) Ubiquitin thioesterase otubain-like protein (EC 3.4.-.-)| (Ubiquitin-specific-processing protease otubain-like) (Deubiquitinating enzyme otubain-like) Length = 284 Score = 50.1 bits (118), Expect = 3e-06 Identities = 28/74 (37%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Frame = +3 Query: 252 VPYIGNKEPLSALAAEFQSG-SPILQEKIKLLGEQYDALRRTRGDGNCFYRSFMFSYLEH 428 VP + P S L AE+ + S K L E Y +R RGDGNCFYR+ + +E Sbjct: 41 VPLVATLAPFSILCAEYDNETSAAFLSKATELSEVYGEIRYIRGDGNCFYRAILVGLIEI 100 Query: 429 ILETQDRAEVERIL 470 +L +DRA +E+ + Sbjct: 101 ML--KDRARLEKFI 112
>OTUB2_HUMAN (Q96DC9) Ubiquitin thioesterase protein OTUB2 (EC 3.4.-.-) (Otubain| 2) (OTU domain-containing ubiquitin aldehyde-binding protein 2) (Ubiquitin-specific-processing protease OTUB2) (Deubiquitinating enzyme OTUB2) Length = 234 Score = 50.1 bits (118), Expect = 3e-06 Identities = 25/57 (43%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = +3 Query: 318 ILQEKIKLLGEQYDALRRTRGDGNCFYRSFMFSYLEHIL--ETQDRAEVERILKTLN 482 I + KI+ L +++ A+R+T+GDGNCFYR+ +SYLE +L + ER+L+T N Sbjct: 27 IYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFKFKERVLQTPN 83
>Y483_CHLPN (Q9Z868) Hypothetical protein CPn_0483/CP0271/CPj0483/CpB0503| Length = 1043 Score = 31.6 bits (70), Expect = 1.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 378 GDGNCFYRSFMFSYLEHILETQDRAEV 458 GDGNCFYR++ +L + E R ++ Sbjct: 262 GDGNCFYRAYAVGWLSALYEESSRNDI 288
>ALP16_SCHPO (P87244) Spindle pole body component alp16 (Altered polarity| protein 16) Length = 759 Score = 30.0 bits (66), Expect = 3.4 Identities = 22/64 (34%), Positives = 32/64 (50%) Frame = +3 Query: 282 SALAAEFQSGSPILQEKIKLLGEQYDALRRTRGDGNCFYRSFMFSYLEHILETQDRAEVE 461 SA +EF+ P LQ + +++G ALR D + Y S FSY+ H+ + Q E Sbjct: 606 SASVSEFEDVYPDLQFQCQVIG----ALRILFTDNSLNYYSKTFSYVLHLFQAQSDFESS 661 Query: 462 RILK 473 LK Sbjct: 662 VELK 665
>NFL_XENLA (P35616) Neurofilament triplet L protein (Neurofilament light| polypeptide) (NF-L) Length = 543 Score = 29.3 bits (64), Expect = 5.8 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 382 SPRVRLKASYCSPSNFIFSCKMGLPDWNSAAKAERGSLLPMYGT 251 SPRV +++SY SPS +S + S A + S LP T Sbjct: 20 SPRVHIRSSYVSPSRTTYSPLVSTTMRRSYATSSSSSFLPSVDT 63
>SPCS2_MOUSE (Q9CYN2) Signal peptidase complex subunit 2 (EC 3.4.-.-)| (Microsomal signal peptidase 25 kDa subunit) (SPase 25 kDa subunit) Length = 226 Score = 28.5 bits (62), Expect = 9.9 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +1 Query: 217 GGGSDGAGPDPRCRTSVTRN 276 GGGS GAG P C TS +R+ Sbjct: 14 GGGSSGAGGGPSCGTSSSRS 33 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,358,797 Number of Sequences: 219361 Number of extensions: 709116 Number of successful extensions: 2145 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2085 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2145 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
