| Clone Name | bast79e03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UCRI_RAT (P20788) Ubiquinol-cytochrome c reductase iron-sulfur s... | 28 | 6.6 | 2 | TIM44_MOUSE (O35857) Import inner membrane translocase subunit T... | 28 | 8.6 |
|---|
>UCRI_RAT (P20788) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) (Liver regeneration-related protein LRRGT00195) Length = 274 Score = 28.5 bits (62), Expect = 6.6 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 6/36 (16%) Frame = -1 Query: 415 AVPVDARPPLLR------CRRNLSDLAADEPVVAVV 326 AVP + PP+L CR +LS AA P+VA V Sbjct: 33 AVPATSEPPVLDVKRPFLCRESLSGQAATRPLVATV 68
>TIM44_MOUSE (O35857) Import inner membrane translocase subunit TIM44,| mitochondrial precursor Length = 452 Score = 28.1 bits (61), Expect = 8.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 134 ADPRRRGGWCCRPVRVLAQGAQLL 205 A R RGGWC P R L G Q L Sbjct: 2 AAARLRGGWCRCPRRCLGSGIQFL 25 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,656,618 Number of Sequences: 219361 Number of extensions: 292019 Number of successful extensions: 988 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 988 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)