| Clone Name | bast79d01 |
|---|---|
| Clone Library Name | barley_pub |
>GYRB_MYXXA (O33367) DNA gyrase subunit B (EC 5.99.1.3)| Length = 815 Score = 32.0 bits (71), Expect = 0.78 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -1 Query: 256 WCSTPAPAPGQWCA-PAAIGILGGSCAITYG-RERTSW 149 WC TP+ P WC+ P + G C+ T R R++W Sbjct: 662 WCRTPSTTPRSWCSTPTRMEPCGRRCSTTPSCRRRSTW 699
>PYGO_DROME (Q9V9W8) Protein pygopus (Protein gammy legs)| Length = 815 Score = 31.6 bits (70), Expect = 1.0 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 Query: 275 HGGPVAMVLHAGSGAGPVVRPGSHRDLGRELRH 177 HGGP M H G G P + G H + G + H Sbjct: 607 HGGPAGMPPHMGGGPNPHMMGGPHGNAGPHMGH 639
>MTP7_PSEAE (P05103) Modification methylase PaeR7I (EC 2.1.1.72)| (Adenine-specific methyltransferase PaeR7I) (M.PaeR7I) Length = 549 Score = 30.0 bits (66), Expect = 2.9 Identities = 19/46 (41%), Positives = 23/46 (50%) Frame = +2 Query: 47 AHRSHYAARWLVTLSG*LALPELARSY*LLSIAGPARPLSTVRNGA 184 AHR L TL+G L+ P L + AGP R L+ V NGA Sbjct: 249 AHRPSIDRATLTTLAGLLSAPTLPKD------AGPVRELARVTNGA 288
>FAT2_RAT (O88277) Protocadherin Fat 2 precursor (Multiple epidermal growth| factor-like domains 1) Length = 4351 Score = 29.6 bits (65), Expect = 3.8 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -1 Query: 253 CSTPAPAPGQWCAPAAIGILGGSCAITYGRERTSW 149 C+ P P G C A G GG C IT +R W Sbjct: 4012 CNCPHPYTGDRCEMEARGCSGGHCLITPEIKRGDW 4046
>ODP2_RALEU (Q59098) Dihydrolipoyllysine-residue acetyltransferase component of| pyruvate dehydrogenase complex (EC 2.3.1.12) (E2) (Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex) Length = 553 Score = 29.6 bits (65), Expect = 3.8 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -1 Query: 271 AGPWPWCSTPAPAPGQWCAPAAIGILGGSCAI 176 A P P + PAPAP APAA GG I Sbjct: 92 AAPAPAAAAPAPAPAPAAAPAAAPAAGGGGTI 123
>IRX5_HUMAN (P78411) Iroquois-class homeodomain protein IRX-5 (Iroquois| homeobox protein 5) (Homeodomain protein IRXB2) (IRX-2A) Length = 482 Score = 29.3 bits (64), Expect = 5.0 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -3 Query: 248 HAGSGAGPVVRPGSHRDLGRELRHYVRSRADELAR 144 H G G GP PGSH + L V +RAD LA+ Sbjct: 423 HPGPGPGPTTGPGSHFN---GLNQTVLNRADALAK 454
>BLVR_BOVIN (Q03368) Bovine leukemia virus cell receptor precursor (BLV-R)| (BLVPCP1) Length = 843 Score = 28.5 bits (62), Expect = 8.6 Identities = 14/40 (35%), Positives = 17/40 (42%), Gaps = 5/40 (12%) Frame = -1 Query: 268 GPWPWCSTPAPAPGQWCAPAAIGILGG-----SCAITYGR 164 GP PW PA G+W A+ +L C T GR Sbjct: 744 GPGPWPPCPAACCGEWWRATALALLSSLDALQVCVCTCGR 783
>KCNC4_RAT (Q63734) Potassium voltage-gated channel subfamily C member 4| (Voltage-gated potassium channel subunit Kv3.4) (Raw3) Length = 625 Score = 28.5 bits (62), Expect = 8.6 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = +3 Query: 342 DSVAFVEMAPGGCGGAGDFDRLDDDQ----LMSMFPDEGGS 452 +++ E GG GGAG D DD+ L + P EGGS Sbjct: 157 EALDIFESPDGGGGGAGPGDEAGDDERELALQRLGPHEGGS 197
>KCNC4_MOUSE (Q8R1C0) Potassium voltage-gated channel subfamily C member 4| (Voltage-gated potassium channel subunit Kv3.4) Length = 628 Score = 28.5 bits (62), Expect = 8.6 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = +3 Query: 342 DSVAFVEMAPGGCGGAGDFDRLDDDQ----LMSMFPDEGGS 452 +++ E GG GGAG D DD+ L + P EGGS Sbjct: 160 EALDIFESPDGGGGGAGPGDEAGDDERELALQRLGPHEGGS 200 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,584,407 Number of Sequences: 219361 Number of extensions: 735849 Number of successful extensions: 2710 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2703 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)