| Clone Name | bast79b11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POL1_TORVR (P29150) RNA1 polyprotein (P1) [Contains: X1 protein;... | 34 | 0.16 | 2 | CXA7_MOUSE (P28229) Gap junction alpha-7 protein (Connexin-45) (... | 30 | 3.1 | 3 | YOM4_CAEEL (Q23202) Hypothetical UPF0023 protein W06E11.4 in chr... | 29 | 5.3 | 4 | ARI4A_HUMAN (P29374) AT-rich interactive domain-containing prote... | 28 | 9.1 |
|---|
>POL1_TORVR (P29150) RNA1 polyprotein (P1) [Contains: X1 protein; X2 protein;| Putative ATP-dependent helicase (EC 3.6.1.-) (NTP-binding protein) (NTB) (Membrane-binding protein); Viral genome-linked protein (VPg); Picornain 3C-like protease (EC 3.4.22.-) Length = 2197 Score = 34.3 bits (77), Expect = 0.16 Identities = 34/128 (26%), Positives = 56/128 (43%), Gaps = 5/128 (3%) Frame = -1 Query: 444 HGGAPWISSL---AEKLDRSLQFHHTKHK--SYTRSCSQDQRITFQIIRRRGNKNLILQF 280 H + W+S AE L R Q +H SY +S S+ F I+++ N + Q+ Sbjct: 948 HPLSEWMSMQELSAELLLRYQQHREAQHAEYSYWKSTSRTSHDVFDILQKCVNGDT--QW 1005 Query: 279 IPIPVELWKPSKLAGT*IPDQIERKRN*TRVRLIHNFIYLFDSRGGEEPISRPDKNRQRR 100 + +PV++ IP I +K RV I I++FD E + +N R Sbjct: 1006 LSLPVDV----------IPPSIRQKHKGNRVFAIDGRIFMFDYMTLEYDEIKEKENLDAR 1055 Query: 99 HTKASSIQ 76 H +A ++ Sbjct: 1056 HLEARILE 1063
>CXA7_MOUSE (P28229) Gap junction alpha-7 protein (Connexin-45) (Cx45)| Length = 396 Score = 30.0 bits (66), Expect = 3.1 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = -2 Query: 116 RIDREDTRKHHQSNPFGPREKGRA*YVGTGNTNRSNL 6 R+D HHQ+NP GPREK +A +N+S++ Sbjct: 348 RLDLAIQAYHHQNNPHGPREK-KAKVGSKSGSNKSSI 383
>YOM4_CAEEL (Q23202) Hypothetical UPF0023 protein W06E11.4 in chromosome III| Length = 253 Score = 29.3 bits (64), Expect = 5.3 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = -3 Query: 415 RRKAR*ISAVPPHETQIIHTKLQPRSTDNIPDNSKEGEQELDTAIHPNS 269 R K + A+P E + +HTKL+ +D D+ ++G E+ I P S Sbjct: 171 RAKMKIRVAIPTKEAKSVHTKLKTLFSDVEVDDWQDGSLEMVGLIEPGS 219
>ARI4A_HUMAN (P29374) AT-rich interactive domain-containing protein 4A (ARID| domain-containing protein 4A) (Retinoblastoma-binding protein 1) (RBBP-1) Length = 1257 Score = 28.5 bits (62), Expect = 9.1 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = -3 Query: 343 RSTDNIPDNSKEGEQELDTAIHPNSGGTVETFKISRHLNSGPNRKKTE 200 RS I + K+GE++ HPNS + T+K S LN N TE Sbjct: 1139 RSPARISPHIKDGEKDKHREKHPNS--SPRTYKWSFQLNELDNMNSTE 1184 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,253,684 Number of Sequences: 219361 Number of extensions: 1510946 Number of successful extensions: 4058 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4057 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)