| Clone Name | bast79a10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SUIS_HUMAN (P14410) Sucrase-isomaltase, intestinal [Contains: Su... | 29 | 6.3 | 2 | ILVE_STRCO (O86505) Probable branched-chain-amino-acid aminotran... | 28 | 8.2 |
|---|
>SUIS_HUMAN (P14410) Sucrase-isomaltase, intestinal [Contains: Sucrase (EC| 3.2.1.48); Isomaltase (EC 3.2.1.10)] Length = 1826 Score = 28.9 bits (63), Expect = 6.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 65 SCVQDQATARGSAADAGCCWR 3 +C+ +Q G A GCCWR Sbjct: 75 NCIPEQFPTEGICAQRGCCWR 95
>ILVE_STRCO (O86505) Probable branched-chain-amino-acid aminotransferase (EC| 2.6.1.42) (BCAT) Length = 362 Score = 28.5 bits (62), Expect = 8.2 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = +3 Query: 195 SSPTVAYHPS---PISCSLSSDHERSRGGGLRRACSDGNLAA 311 +SP AY P P+S +S D R+ GG+ A + GN AA Sbjct: 168 ASPAGAYFPGGVKPVSIWVSEDRVRAVPGGMGDAKTGGNYAA 209 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,220,635 Number of Sequences: 219361 Number of extensions: 402299 Number of successful extensions: 1474 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1472 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)