| Clone Name | bast78h07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TAOK2_RAT (Q9JLS3) Serine/threonine-protein kinase TAO2 (EC 2.7.... | 29 | 3.9 |
|---|
>TAOK2_RAT (Q9JLS3) Serine/threonine-protein kinase TAO2 (EC 2.7.11.1) (Thousand| and one amino acid protein 2) Length = 1235 Score = 28.9 bits (63), Expect = 3.9 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -2 Query: 165 ARGRTAGMPASSSYARGPCPLPLHLISAWLVDW 67 A+G G S S+ RG +PL L +AWL+ W Sbjct: 1023 AQGTALGAVLSLSWRRGLMGVPLGLGAAWLLAW 1055 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,929,179 Number of Sequences: 219361 Number of extensions: 429690 Number of successful extensions: 1444 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1444 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)