| Clone Name | bast78h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DPYL1_RAT (Q62950) Dihydropyrimidinase-related protein 1 (DRP-1)... | 28 | 9.1 | 2 | DPYL1_MOUSE (P97427) Dihydropyrimidinase-related protein 1 (DRP-... | 28 | 9.1 | 3 | DPYL1_HUMAN (Q14194) Dihydropyrimidinase-related protein 1 (DRP-... | 28 | 9.1 |
|---|
>DPYL1_RAT (Q62950) Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin| response mediator protein 1) (CRMP-1) Length = 572 Score = 28.5 bits (62), Expect = 9.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 270 MRGAVYYVQSPSRDSHDGETTTKGATSVHSTPALSPMASP 389 +R V+ + S SR +DG AT H+ PA S +SP Sbjct: 484 IRSKVFGLHSVSRGMYDGPVYEVPATPKHAAPAPSAKSSP 523
>DPYL1_MOUSE (P97427) Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin| response mediator protein 1) (CRMP-1) (ULIP3 protein) Length = 572 Score = 28.5 bits (62), Expect = 9.1 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 270 MRGAVYYVQSPSRDSHDGETTTKGATSVHSTPALSPMASP 389 +R V+ + S SR +DG AT H+ PA S +SP Sbjct: 484 IRSKVFGLHSVSRGMYDGPVYEVPATPKHAAPAPSAKSSP 523
>DPYL1_HUMAN (Q14194) Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin| response mediator protein 1) (CRMP-1) Length = 572 Score = 28.5 bits (62), Expect = 9.1 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 270 MRGAVYYVQSPSRDSHDGETTTKGATSVHSTPALSPMASP 389 +R V+ +Q SR +DG AT ++TPA S +SP Sbjct: 484 IRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSP 523 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.306 0.116 0.279 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,318,195 Number of Sequences: 219361 Number of extensions: 349316 Number of successful extensions: 838 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)