| Clone Name | bast78g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HIS2_THET2 (P62350) Histidine biosynthesis bifunctional protein ... | 29 | 3.0 | 2 | FULI_ACHFU (P35905) Fulicin precursor [Contains: Fulicin; Fucili... | 28 | 5.1 | 3 | RSTA_ECOLI (P52108) Transcriptional regulatory protein rstA | 28 | 6.7 |
|---|
>HIS2_THET2 (P62350) Histidine biosynthesis bifunctional protein hisIE| [Includes: Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) (PRA-CH); Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (PRA-PH)] Length = 214 Score = 29.3 bits (64), Expect = 3.0 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +2 Query: 20 TVAPANTKVTLATFDLPYITFYYNQKLLLYRLAEGAGDFQDVTARMVDALGDAL 181 T+A AN + T TF+ + L+R E +G Q+V ++D GDA+ Sbjct: 28 TLAYANREALEETLRTRRSTFFSRSRQALWRKGETSGHTQEVVEVLLDCDGDAV 81
>FULI_ACHFU (P35905) Fulicin precursor [Contains: Fulicin; Fucilin gene-related| peptide 1 (FGRP-1); Fucilin gene-related peptide 2 (FGRP-2); Fucilin gene-related peptide 3 (FGRP-3); Fucilin gene-related peptide 4 (FGRP-4); Fucilin gene-related peptide 5 ( Length = 357 Score = 28.5 bits (62), Expect = 5.1 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = +2 Query: 11 GTRTVAPANTKVTLATFDLPYITFYYNQKLLLYRLAEGAGDFQDVTARMVDALG 172 G TV+P++TK++ LPY++ + AGD DV R + LG Sbjct: 265 GVFTVSPSSTKISFDDNYLPYLS------------SVDAGDLSDVNKRYAEFLG 306
>RSTA_ECOLI (P52108) Transcriptional regulatory protein rstA| Length = 242 Score = 28.1 bits (61), Expect = 6.7 Identities = 19/54 (35%), Positives = 26/54 (48%) Frame = +2 Query: 11 GTRTVAPANTKVTLATFDLPYITFYYNQKLLLYRLAEGAGDFQDVTARMVDALG 172 GT T+ P N VTLA ++ T + LL+ LA AG D A + + G Sbjct: 145 GTLTIDPINRVVTLANTEISLSTADFE---LLWELATHAGQIMDRDALLKNLRG 195 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,445,585 Number of Sequences: 219361 Number of extensions: 169653 Number of successful extensions: 656 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 654 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)