| Clone Name | bast78f12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MPA51_PHAAQ (P56164) Major pollen allergen Pha a 5.1 precursor (... | 29 | 5.1 | 2 | AROA_RHILO (Q98CC1) 3-phosphoshikimate 1-carboxyvinyltransferase... | 29 | 5.1 | 3 | RARB_MOUSE (P22605) Retinoic acid receptor beta (RAR-beta) | 26 | 8.5 | 4 | DREB_RAT (Q07266) Drebrin (Developmentally-regulated brain protein) | 28 | 8.8 |
|---|
>MPA51_PHAAQ (P56164) Major pollen allergen Pha a 5.1 precursor (Pha A 5) (Clone| 28) Length = 320 Score = 28.9 bits (63), Expect = 5.1 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +1 Query: 67 RFTQRLLL---LAASSSIPNPPADEEPPMLHGPKAAPRMTRRS 186 ++T L L L A + P PP PP+L P+A + T S Sbjct: 5 KYTMALFLAVALVAGPAAPTPPTPRTPPLLPPPRARDKATLTS 47
>AROA_RHILO (Q98CC1) 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19)| (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) Length = 452 Score = 28.9 bits (63), Expect = 5.1 Identities = 14/27 (51%), Positives = 15/27 (55%) Frame = +1 Query: 121 PADEEPPMLHGPKAAPRMTRRSPCRSA 201 P D P LHGPK A +T R P SA Sbjct: 149 PGDRMPITLHGPKHAAPITYRVPMASA 175
>RARB_MOUSE (P22605) Retinoic acid receptor beta (RAR-beta)| Length = 482 Score = 25.8 bits (55), Expect(2) = 8.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +3 Query: 45 LRLPLSRSIHTEAPPPGCFFLNPQSAGR 128 L LP +H PP GC +P S G+ Sbjct: 36 LSLPPLHGLHGHPPPSGCSTPSPASVGQ 63 Score = 20.8 bits (42), Expect(2) = 8.5 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +1 Query: 109 IPNPPADEEPPMLHGP 156 +P+PP+ PP ++ P Sbjct: 99 VPSPPSPLPPPRVYKP 114
>DREB_RAT (Q07266) Drebrin (Developmentally-regulated brain protein)| Length = 706 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 100 SSSIPNPPADEEPPMLHGPKAAPRMTRRSPCRSA 201 +SS P PP PP ++APR+ C+ A Sbjct: 405 TSSQPPPPPPPPPPAQEAQESAPRLDGEEVCKEA 438 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,944,214 Number of Sequences: 219361 Number of extensions: 602834 Number of successful extensions: 2426 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2421 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)