| Clone Name | bast78e05 |
|---|---|
| Clone Library Name | barley_pub |
>CO9A1_HUMAN (P20849) Collagen alpha-1(IX) chain precursor| Length = 921 Score = 30.4 bits (67), Expect = 2.2 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +3 Query: 321 SLPSKPRSPILAAGARAVFALCD---VGTPWRSQWKLFSC 431 SLP KPR PI G + L D V P+ QW L C Sbjct: 203 SLPIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHC 242
>POLG_PRSVW (P19724) Genome polyprotein [Contains: Nuclear inclusion protein B| (NI-B) (NIB) (RNA-directed RNA polymerase) (EC 2.7.7.48); Coat protein (CP)] (Fragment) Length = 675 Score = 30.0 bits (66), Expect = 2.9 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 418 FHWLRQGVPTSQSAKTARAP-AARMGLRGLEGSERG 314 + W+ + P ++ AK RAP + +GLR L SERG Sbjct: 305 YQWVLEQAPFNELAKQGRAPYVSEVGLRRLYTSERG 340
>POLG_PRSVP (P19723) Genome polyprotein [Contains: Nuclear inclusion protein B| (NI-B) (NIB) (RNA-directed RNA polymerase) (EC 2.7.7.48); Coat protein (CP)] (Fragment) Length = 675 Score = 30.0 bits (66), Expect = 2.9 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 418 FHWLRQGVPTSQSAKTARAP-AARMGLRGLEGSERG 314 + W+ + P ++ AK RAP + +GLR L SERG Sbjct: 305 YQWVLEQAPFNELAKQGRAPYVSEVGLRRLYTSERG 340
>POLG_PRSVH (Q01901) Genome polyprotein [Contains: P1 proteinase (N-terminal| protein); Helper component proteinase (EC 3.4.22.45) (HC-pro); Protein P3; 6 kDa protein 1 (6K1); Cytoplasmic inclusion protein (EC 3.6.1.-) (CI); 6 kDa protein 2 (6K2); Viral ge Length = 3344 Score = 30.0 bits (66), Expect = 2.9 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 418 FHWLRQGVPTSQSAKTARAP-AARMGLRGLEGSERG 314 + W+ + P ++ AK RAP + +GLR L SERG Sbjct: 2974 YQWVLEQAPFNELAKQGRAPYVSEVGLRRLYTSERG 3009
>Y1115_HALSA (Q9HQK7) Hypothetical UPF0066 protein Vng1115h| Length = 124 Score = 29.6 bits (65), Expect = 3.8 Identities = 21/65 (32%), Positives = 29/65 (44%) Frame = -3 Query: 406 RQGVPTSQSAKTARAPAARMGLRGLEGSERGCFIHLSDPSDGE*ESAASSVRTSTTPPGP 227 RQGV T +A + R GL GLE +R + +D +D + + R T P Sbjct: 21 RQGVETPYAANVQVYESFRGGLVGLEPDDRVVVVWWADDADRDVLAVRDGDRGVFTTRSP 80 Query: 226 ARTVP 212 AR P Sbjct: 81 ARPNP 85
>LEU2_HALVO (Q7ZAG7) 3-isopropylmalate dehydratase large subunit (EC 4.2.1.33)| (Isopropylmalate isomerase) (Alpha-IPM isomerase) (IPMI) Length = 473 Score = 29.3 bits (64), Expect = 4.9 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 397 VPTSQSAKTARAPAARMGLRGLEGSERGCFIHLSDPSDGE 278 VPTS ++ R AA + LE + R I+ SDP+ GE Sbjct: 66 VPTSDQSRPFRDDAAEEMMAELEQNVREAGINFSDPTSGE 105
>MAX_XENLA (Q07016) Protein max (Myc-associated factor X) (xMAX)| Length = 163 Score = 28.9 bits (63), Expect = 6.4 Identities = 18/65 (27%), Positives = 27/65 (41%) Frame = -3 Query: 421 SFHWLRQGVPTSQSAKTARAPAARMGLRGLEGSERGCFIHLSDPSDGE*ESAASSVRTST 242 SFH LR VP+ Q K +RA ++ R H D D + ++A + Sbjct: 42 SFHGLRDSVPSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVQI 101 Query: 241 TPPGP 227 + P P Sbjct: 102 SNPKP 106 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,470,704 Number of Sequences: 219361 Number of extensions: 524641 Number of successful extensions: 2175 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2174 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)