ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast78c03 |
|---|---|
| Clone Library Name | barley_pub |
>Y585_METJA (Q58005) Hypothetical protein MJ0585| Length = 205 Score = 32.0 bits (71), Expect = 0.88 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 8/65 (12%) Frame = +2 Query: 275 LKWLAFIAAVYLLVLDRTNW---KTNMLT-----GLLVPYIFFTLPGVLFSLIRGEVGAW 430 +KW I+ + L ++ T W K L GL+VP++ F +P LF+++ + + Sbjct: 104 MKWFIAISILILGIILATLWILRKDKFLLFLAIFGLIVPFLQFKIPNWLFNILALPLFVY 163 Query: 431 IAFIV 445 I FIV Sbjct: 164 IKFIV 168
>LAX5_MEDTR (Q8L883) Auxin transporter-like protein 5 (AUX1-like protein 5)| (MtLAX5) Length = 490 Score = 30.8 bits (68), Expect = 2.0 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +2 Query: 356 LLVPYIFFTL---PGVLFSLIRGEVGAWIAFIVVIL 454 L +PY F L G+LF L G +G+W A+++ IL Sbjct: 61 LTLPYSFSQLGMLSGILFQLFYGILGSWTAYLISIL 96
>ACTP_PHOLL (Q7NA72) Cation/acetate symporter actP (Acetate transporter actP)| (Acetate permease) Length = 549 Score = 30.8 bits (68), Expect = 2.0 Identities = 18/51 (35%), Positives = 27/51 (52%) Frame = +2 Query: 281 WLAFIAAVYLLVLDRTNWKTNMLTGLLVPYIFFTLPGVLFSLIRGEVGAWI 433 WL I AV L++L T W + + G P + P LFS+I +G+W+ Sbjct: 466 WLGLITAVVLMILGPTIWVS--ILGHEKPIYPYEYP-ALFSMIIAFIGSWL 513
>CRCB_NEIMB (Q9JZG6) Protein crcB homolog| Length = 119 Score = 30.8 bits (68), Expect = 2.0 Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 200 LGMAARKLANHAIVXXXXXXXXRHFLKWL-AFIAAVYLLVLDRTNWKTNMLTGLL 361 LG AR L N A+ F W+ AF+ ++ ++ WK ++TG L Sbjct: 14 LGATARWLLNLAVPASIPPATGNLFANWIGAFLIGIFAETVNHPQWKLLLITGFL 68
>LAX2_ARATH (Q9S836) Auxin transporter-like protein 2 (AUX1-like protein 2)| Length = 483 Score = 30.8 bits (68), Expect = 2.0 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +2 Query: 356 LLVPYIFFTL---PGVLFSLIRGEVGAWIAFIVVIL 454 L +PY F L G+LF L G +G+W A+++ IL Sbjct: 59 LTLPYSFSQLGMLSGILFQLFYGILGSWTAYLISIL 94
>AGAR_STRCO (P07883) Extracellular agarase precursor (EC 3.2.1.81)| Length = 309 Score = 30.4 bits (67), Expect = 2.6 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 5/49 (10%) Frame = +1 Query: 337 DQHADGTLGPLHFLHPARRAFLSD-----KGRGWCLDCVHCGHPAALLP 468 DQH DG GP + L+ AR ++++D +GR V+CG+ + P Sbjct: 75 DQHKDGWSGPANSLYSARHSWVADGNLIVEGRRAPDGRVYCGYVTSRTP 123
>CRCB_NEIMA (Q9JUL1) Protein crcB homolog| Length = 119 Score = 30.4 bits (67), Expect = 2.6 Identities = 16/55 (29%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Frame = +2 Query: 200 LGMAARKLANHAIVXXXXXXXXRHFLKWL-AFIAAVYLLVLDRTNWKTNMLTGLL 361 LG AR L N A+ F W AF+ ++ ++ WK ++TG L Sbjct: 14 LGATARWLLNLAVPASLSPATGNLFANWTGAFLIGIFAETVNHPQWKLLLITGFL 68
>LAX3_MEDTR (Q9FEL6) Auxin transporter-like protein 3 (AUX1-like protein 3)| (MtLAX3) Length = 465 Score = 30.4 bits (67), Expect = 2.6 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +2 Query: 356 LLVPYIFFTL---PGVLFSLIRGEVGAWIAFIVVIL 454 L +PY F L G+LF + G +G+W A+I+ +L Sbjct: 58 LTLPYSFSQLGMLSGILFQIFYGLMGSWTAYIISVL 93
>LAX3_ARATH (Q9CA25) Auxin transporter-like protein 3 (AUX1-like protein 3)| Length = 470 Score = 30.4 bits (67), Expect = 2.6 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = +2 Query: 356 LLVPYIFFTL---PGVLFSLIRGEVGAWIAFIVVIL 454 L +PY F L G+LF L G +G+W A+++ +L Sbjct: 63 LTLPYSFSQLGMMSGILFQLFYGLMGSWTAYLISVL 98
>ACTP_YERPS (Q66FN0) Cation/acetate symporter actP (Acetate transporter actP)| (Acetate permease) Length = 551 Score = 30.0 bits (66), Expect = 3.3 Identities = 19/50 (38%), Positives = 24/50 (48%) Frame = +2 Query: 281 WLAFIAAVYLLVLDRTNWKTNMLTGLLVPYIFFTLPGVLFSLIRGEVGAW 430 WL AV L++L T W T + G P + P LFS+I VG W Sbjct: 468 WLGLSTAVILMILGPTIWVT--ILGHEKPIYPYEYP-ALFSMIAAFVGTW 514
>ACTP_YERPE (Q8ZJ73) Cation/acetate symporter actP (Acetate transporter actP)| (Acetate permease) Length = 551 Score = 30.0 bits (66), Expect = 3.3 Identities = 19/50 (38%), Positives = 24/50 (48%) Frame = +2 Query: 281 WLAFIAAVYLLVLDRTNWKTNMLTGLLVPYIFFTLPGVLFSLIRGEVGAW 430 WL AV L++L T W T + G P + P LFS+I VG W Sbjct: 468 WLGLSTAVILMILGPTIWVT--ILGHEKPIYPYEYP-ALFSMIAAFVGTW 514
>GTR14_HUMAN (Q8TDB8) Solute carrier family 2, facilitated glucose transporter| member 14 (Glucose transporter type 14) Length = 520 Score = 29.3 bits (64), Expect = 5.7 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +2 Query: 326 TNWKTNMLTGLLVPYIFFTLPGVLFSLIRGEVGAWIAF 439 +NW +N L GLL P + L +F + G + ++AF Sbjct: 432 SNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAF 469
>INVO_TARBA (P24711) Involucrin| Length = 387 Score = 29.3 bits (64), Expect = 5.7 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 12/67 (17%) Frame = -3 Query: 466 EEEPQDDHNERNPGTNLS-PYQREKHAGQ-----------GEENVRDQESRQHVGLPVCP 323 ++EPQ+ E +PG P ++E H G+ G++ + QE H+G Sbjct: 86 QQEPQEQ--EVHPGKQQQKPQEQEAHLGKKQEPQGQEVHLGKQQQKTQEQEVHLGKQQQE 143 Query: 322 VQYQEVH 302 +Q QEVH Sbjct: 144 LQEQEVH 150 Score = 28.5 bits (62), Expect = 9.7 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = -3 Query: 466 EEEPQDDHNERNPGTNLSPYQREKHAGQGEENVRDQESRQHVGLPVCPVQYQEVHGG 296 E + Q+ H + P +E H G+ ++ +++QE H+G + Q QE+H G Sbjct: 251 ESQEQELHLRKLQQVPQEPQDQELHLGKQQQELQEQE--VHLGKQLQEPQEQELHLG 305
>YNI7_YEAST (P48231) Hypothetical 132.5 kDa protein in TOP2-MKT1 intergenic| region Length = 1178 Score = 29.3 bits (64), Expect = 5.7 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 1 STNQTPSPRPSIHPCAELDPHSARLEIFPGLGDSGEDGAVV 123 STN S ++ P + +DP S P +G GEDG V+ Sbjct: 1059 STNSNRSIGKAVVPLSTIDPESDTTFNIPLVGPKGEDGGVL 1099
>CRTC1_ARATH (O04151) Calreticulin-1 precursor| Length = 425 Score = 28.9 bits (63), Expect = 7.5 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 475 SDVEEEPQDDHNERNPGTNLSPYQREKHAGQGEE 374 SD EEE +DD NE + N S + K A + +E Sbjct: 381 SDAEEEAEDDDNEGDDSDNESKSEETKEAEETKE 414
>GTR3_CANFA (P47842) Solute carrier family 2, facilitated glucose transporter| member 3 (Glucose transporter type 3, brain) Length = 495 Score = 28.9 bits (63), Expect = 7.5 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 326 TNWKTNMLTGLLVPYIFFTLPGVLFSLIRGEVGAWIAF 439 +NW +N L GLL P F L +F + G + ++ F Sbjct: 408 SNWTSNFLVGLLFPSAAFYLGAYVFIIFTGFLIVFLVF 445
>APC_XENLA (P70039) Adenomatous polyposis coli homolog (Protein APC)| Length = 2829 Score = 28.9 bits (63), Expect = 7.5 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 466 EEEPQDDHNERNPGTNLSPYQREKHAGQ 383 EEE Q+D ER N+ Y E+H G+ Sbjct: 1151 EEEQQEDETERQNKYNIKAYASEEHHGE 1178
>LAX1_ORYSA (Q5N892) Auxin transporter-like protein 1| Length = 492 Score = 28.5 bits (62), Expect = 9.7 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +2 Query: 356 LLVPYIFFTL---PGVLFSLIRGEVGAWIAFIVVIL 454 L +PY F L GVL L G +G+W A+++ +L Sbjct: 73 LTLPYSFSQLGMLSGVLLQLFYGFMGSWTAYLISVL 108
>KCNG1_HUMAN (Q9UIX4) Potassium voltage-gated channel subfamily G member 1| (Voltage-gated potassium channel subunit Kv6.1) (kH2) Length = 513 Score = 28.5 bits (62), Expect = 9.7 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = -3 Query: 469 VEEEPQDDHNERNPGTNLSPYQREKHAGQGEENVRDQESRQHVGLP 332 VE E +DD + + P + E G+ +RD R H GLP Sbjct: 180 VEREEEDDALDSEGRDSEGPAEGEGRLGRCMRRLRDMVERPHSGLP 225
>TTLL4_MOUSE (Q80UG8) Tubulin--tyrosine ligase-like protein 4| Length = 1193 Score = 28.5 bits (62), Expect = 9.7 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = -3 Query: 478 GSDVEEEPQDDHNERNPGTNLSPYQREKHAGQGEENVRDQESRQHVGLPV 329 G+ + E + + LSP R+ + + EN Q R GLPV Sbjct: 1115 GTTLSSEDRSTPKSKKSQAGLSPISRKTLSSRSNENTSKQSKRSTPGLPV 1164
>SRCH_RABIT (P16230) Sarcoplasmic reticulum histidine-rich calcium-binding| protein precursor Length = 852 Score = 28.5 bits (62), Expect = 9.7 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -3 Query: 466 EEEPQDDHNERNPGTNLSPYQREKHAGQGEENVRDQE 356 EEE DD ++ T +Q +H G EE D + Sbjct: 318 EEEDDDDDDDEGDSTESDRHQAHRHRGHREEEDEDDD 354
>RB6I2_HUMAN (Q8IUD2) RAB6-interacting protein 2 (ERC protein 1)| Length = 1116 Score = 28.5 bits (62), Expect = 9.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 4 TNQTPSPRPSIHPCAELDPHSARLEIFPG 90 TN PSP I P ELD + ++L+++ G Sbjct: 1000 TNHKPSPDQIIQPLLELDQNRSKLKLYIG 1028
>IWS1_CRYNE (Q5KJR1) Transcription factor IWS1| Length = 475 Score = 28.5 bits (62), Expect = 9.7 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = -3 Query: 472 DVEEEPQDDHNERNPGTNLSPYQREKHAGQGEENVRDQESR 350 +V+EEP+ DH + + ++E+ +E ++DQE + Sbjct: 35 EVQEEPESDHQDDDEQPEAQVLEQEQEQVAEQERLQDQEDQ 75
>RB6I2_MOUSE (Q99MI1) RAB6-interacting protein 2 (ERC protein 1) (ERC1)| (CAZ-associated structural protein 2) (CAST2) Length = 1120 Score = 28.5 bits (62), Expect = 9.7 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 4 TNQTPSPRPSIHPCAELDPHSARLEIFPG 90 TN PSP I P ELD + ++L+++ G Sbjct: 1004 TNHKPSPDQIIQPLLELDQNRSKLKLYIG 1032 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,588,002 Number of Sequences: 219361 Number of extensions: 882934 Number of successful extensions: 3507 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 3374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3501 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
