| Clone Name | bast78b06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VE2_HPV10 (P36781) Regulatory protein E2 | 31 | 1.4 | 2 | ZN672_HUMAN (Q499Z4) Zinc finger protein 672 | 30 | 1.9 | 3 | ZN672_MOUSE (Q99LH4) Zinc finger protein 672 | 30 | 3.2 | 4 | ZN672_RAT (Q642B2) Zinc finger protein 672 | 29 | 4.1 |
|---|
>VE2_HPV10 (P36781) Regulatory protein E2| Length = 376 Score = 30.8 bits (68), Expect = 1.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -1 Query: 413 TTNEITSPSGFCASPSTPASADAQTSRCSMPAQ 315 +T EI++P C S +TPAS AQ P Q Sbjct: 205 STREISTPGPVCTSNTTPASTQAQVGASEGPEQ 237
>ZN672_HUMAN (Q499Z4) Zinc finger protein 672| Length = 452 Score = 30.4 bits (67), Expect = 1.9 Identities = 16/36 (44%), Positives = 21/36 (58%) Frame = -3 Query: 414 HHQRDHVPERLLRQPLDAGQRRRADLPVQHARAMPV 307 H +R H+PER R PL A R++ L ARA P+ Sbjct: 117 HRRRQHLPERPRRCPLCARTFRQSALLFHQARAHPL 152
>ZN672_MOUSE (Q99LH4) Zinc finger protein 672| Length = 468 Score = 29.6 bits (65), Expect = 3.2 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -3 Query: 414 HHQRDHVPERLLRQPLDAGQRRRADLPVQHARAMP 310 H R H PE+ R PL A R++ LP ARA P Sbjct: 118 HRARQHPPEKPHRCPLCARSFRQSALPFHLARAHP 152
>ZN672_RAT (Q642B2) Zinc finger protein 672| Length = 468 Score = 29.3 bits (64), Expect = 4.1 Identities = 16/35 (45%), Positives = 19/35 (54%) Frame = -3 Query: 414 HHQRDHVPERLLRQPLDAGQRRRADLPVQHARAMP 310 H R H PE+ R PL A R++ LP ARA P Sbjct: 118 HRVRQHPPEKPHRCPLCARSFRQSALPFHLARAHP 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,004,392 Number of Sequences: 219361 Number of extensions: 392491 Number of successful extensions: 1299 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1298 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)