| Clone Name | bast77h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y875_SYNY3 (P73555) Hypothetical protein sll0875 | 43 | 4e-04 | 2 | KPRS3_ORYSA (Q8S2E5) Ribose-phosphate pyrophosphokinase 3 (EC 2.... | 29 | 6.6 |
|---|
>Y875_SYNY3 (P73555) Hypothetical protein sll0875| Length = 258 Score = 42.7 bits (99), Expect = 4e-04 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = +2 Query: 368 YVLGTLTWRAFGPRGYLLVAAYFVVGTAVT 457 +VLG + W A G RGYL+V AYF VG+AVT Sbjct: 49 WVLGVIIWAALGWRGYLVVLAYFFVGSAVT 78
>KPRS3_ORYSA (Q8S2E5) Ribose-phosphate pyrophosphokinase 3 (EC 2.7.6.1)| (Phosphoribosyl pyrophosphate synthetase 3) Length = 409 Score = 28.9 bits (63), Expect = 6.6 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 136 PAPGPSPDRCFAAPVPRPSA 195 P+P PSP FA P PR SA Sbjct: 28 PSPSPSPASAFARPSPRASA 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.130 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,361,791 Number of Sequences: 219361 Number of extensions: 394741 Number of successful extensions: 1466 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1463 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)