| Clone Name | bast77f03 |
|---|---|
| Clone Library Name | barley_pub |
>CALX_SOYBN (Q39817) Calnexin homolog precursor| Length = 546 Score = 28.5 bits (62), Expect = 5.1 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 15 KPQSEDERRSLPRAMAAPPDSKSDKSPEELL 107 KP+ DER +P A PD + +P E+L Sbjct: 239 KPEDWDERAKIPDPSAVKPDDWDEDAPMEIL 269
>ENV_FIVPE (P16090) Env polyprotein (GP150 polyprotein) [Contains: Major| glycoprotein GP100; Glycoprotein GP36] Length = 856 Score = 28.5 bits (62), Expect = 5.1 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = +1 Query: 16 NLKAKT----REGRYLGQWRRRRTASLINPQRSSCARRR 120 +LKAKT REG LG W R A+L C R R Sbjct: 214 HLKAKTNISIREGPTLGNWAREIWATLFKKATRQCRRGR 252
>TCF8_HUMAN (P37275) Transcription factor 8 (NIL-2-A zinc finger protein)| (Negative regulator of IL2) Length = 1124 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 91 PQRSSCARRRRPVTTMLSPSLFPLALTPPT 180 PQ+ SC PV ++ PS P+ + PT Sbjct: 777 PQKDSCVTDSEPVVNVIPPSANPINIAIPT 806
>GLR36_ARATH (Q84W41) Glutamate receptor 3.6 precursor (Ligand-gated ion channel| 3.6) Length = 903 Score = 28.1 bits (61), Expect = 6.7 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +1 Query: 55 QWRRRRTASLINPQRSSCARRRRPVTTMLSPSLFPLALTPPT 180 Q+ T ++I PQRS+ AR V T L + + T PT Sbjct: 89 QFMESETVAIIGPQRSTTARVVAHVATELKIPILSFSATDPT 130
>FUTSC_DROME (Q9W596) Microtubule-associated protein futsch| Length = 5412 Score = 28.1 bits (61), Expect = 6.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 21 QSEDERRSLPRAMAAPPDSKSDKSPEELL 107 + ++ RR PP +K DKSP+E+L Sbjct: 2389 EKQESRRESKTESVIPPKAKDDKSPKEVL 2417
>CI047_HUMAN (Q6ZRZ4) Protein C9orf47 precursor| Length = 202 Score = 28.1 bits (61), Expect = 6.7 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = +1 Query: 85 INPQRSSCARRRRPV---TTMLSPSLFPLALTPPTF 183 I P + S + R+ P T+ L PSLFPL L P F Sbjct: 18 IGPNKPSLSGRQAPAQAQTSDLVPSLFPLGLWAPGF 53
>CALX_HELTU (Q39994) Calnexin homolog precursor| Length = 540 Score = 28.1 bits (61), Expect = 6.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 15 KPQSEDERRSLPRAMAAPPDSKSDKSPEELL 107 KP+ DER +P A PD + +P E+L Sbjct: 234 KPEDWDERAKIPDPEATKPDDWDEDAPMEIL 264
>RL19_CAEEL (O02639) 60S ribosomal protein L19| Length = 198 Score = 27.7 bits (60), Expect = 8.8 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 34 REGRYLGQWRRRRTASLINPQRSSCARRRRPVTTML 141 R+GR+ G +RR TA+ P+++ RR R + +L Sbjct: 71 RKGRHTGYGKRRGTANARMPEKTLWIRRMRVLRNLL 106
>TCF8_RAT (Q62947) Transcription factor 8 (Zinc finger homeodomain| enhancer-binding protein) (Zfhep) Length = 1109 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 91 PQRSSCARRRRPVTTMLSPSLFPLALTPPT 180 PQ+ SC PV ++ PS P+ + PT Sbjct: 755 PQKDSCVTDSEPVVNVVPPSANPINIAIPT 784
>TCF8_MOUSE (Q64318) Transcription factor 8 (Zinc finger homeobox protein 1a)| (MEB1) (Delta EF1) Length = 1117 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 91 PQRSSCARRRRPVTTMLSPSLFPLALTPPT 180 PQ+ SC PV ++ PS P+ + PT Sbjct: 755 PQKDSCVTDSEPVVNVVPPSANPINIAIPT 784 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,762,588 Number of Sequences: 219361 Number of extensions: 184859 Number of successful extensions: 788 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 786 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)