| Clone Name | bast77d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CYF_ODOSI (P49476) Apocytochrome f precursor | 28 | 5.4 | 2 | BYN_DROME (P55965) T-related protein (Trp) (Protein brachyenteron) | 28 | 7.1 | 3 | GDF6_BOVIN (P55106) Growth/differentiation factor 6 precursor (G... | 28 | 9.3 | 4 | TRX2_MOUSE (O08550) Trithorax homolog 2 (WW domain-binding prote... | 28 | 9.3 |
|---|
>CYF_ODOSI (P49476) Apocytochrome f precursor| Length = 314 Score = 28.5 bits (62), Expect = 5.4 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 20 PRYEGESRGRS-LKPAGEQGDVNGGGAVLRG 109 P Y G +RGR + P GE+ ++N GAV G Sbjct: 177 PLYAGGNRGRGQVYPTGEKSNINSFGAVQAG 207
>BYN_DROME (P55965) T-related protein (Trp) (Protein brachyenteron)| Length = 697 Score = 28.1 bits (61), Expect = 7.1 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 2 ASHNYRPRYEGESRGRSLKPAGEQGDVNGGGAVLRGP 112 AS + + ++ + SL+ AGE+G V GG AV+ P Sbjct: 635 ASSSLKSSHDIKIESSSLEHAGERGTVGGGAAVVSVP 671
>GDF6_BOVIN (P55106) Growth/differentiation factor 6 precursor (GDF-6)| (Cartilage-derived morphogenetic protein 2) (CDMP-2) (Fragment) Length = 436 Score = 27.7 bits (60), Expect = 9.3 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -3 Query: 120 PRAGPRSTAPPPLTSPCSPAGFRDLPLLSPS 28 P G + PPP P P+G D L SPS Sbjct: 280 PGGGAEGSGPPPPPPPPPPSGTPDAGLWSPS 310
>TRX2_MOUSE (O08550) Trithorax homolog 2 (WW domain-binding protein 7)| (Fragment) Length = 290 Score = 27.7 bits (60), Expect = 9.3 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -3 Query: 120 PRAGPRSTAPPPLTSPCSPAGFRDLPLLSPSY 25 P P ST+PPP SP P PL P Y Sbjct: 52 PPLPPPSTSPPPPASPLPPPVSPPPPLSPPPY 83 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,755,596 Number of Sequences: 219361 Number of extensions: 260960 Number of successful extensions: 1501 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1499 length of database: 80,573,946 effective HSP length: 16 effective length of database: 77,064,170 effective search space used: 1849540080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)