ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bast77d06 |
|---|---|
| Clone Library Name | barley_pub |
>TINY_ARATH (Q39127) Transcriptional factor TINY| Length = 218 Score = 57.0 bits (136), Expect = 3e-08 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +3 Query: 378 GKHPVYRGVRMRAWGKWVSEIREPRK 455 GKHPVYRGVR R WGKWVSEIREPRK Sbjct: 31 GKHPVYRGVRKRNWGKWVSEIREPRK 56
>DRE1B_ARATH (P93835) Dehydration-responsive element-binding protein 1B (DREB1B| protein) (C-repeat-binding factor 1) (C-repeat/dehydration-responsive element-binding factor 1) (CRT/DRE-binding factor 1) Length = 213 Score = 45.8 bits (107), Expect = 6e-05 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = +3 Query: 381 KHPVYRGVRMRAWGKWVSEIREPRK 455 +HP+YRGVR R GKWVSE+REP K Sbjct: 44 RHPIYRGVRQRNSGKWVSEVREPNK 68
>DRE2F_ARATH (Q9SVX5) Dehydration-responsive element-binding protein 2F (DREB2F| protein) Length = 277 Score = 44.3 bits (103), Expect = 2e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRK 455 YRGVR R WGKWV+EIREP+K Sbjct: 28 YRGVRQRTWGKWVAEIREPKK 48
>DRE1D_ARATH (Q9FJ93) Dehydration-responsive element-binding protein 1D (DREB1D| protein) (C-repeat-binding factor 4) (C-repeat/dehydration-responsive element-binding factor 4) (CRT/DRE-binding factor 4) Length = 224 Score = 43.9 bits (102), Expect = 2e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = +3 Query: 381 KHPVYRGVRMRAWGKWVSEIREPRK 455 +HP+YRGVR R GKWV E+REP K Sbjct: 50 RHPIYRGVRQRNSGKWVCEVREPNK 74
>DRE2B_ARATH (O82133) Dehydration-responsive element-binding protein 2B (DREB2B| protein) Length = 330 Score = 43.9 bits (102), Expect = 2e-04 Identities = 17/26 (65%), Positives = 20/26 (76%) Frame = +3 Query: 375 DGKHPVYRGVRMRAWGKWVSEIREPR 452 D H +RGVR R WGKWV+EIREP+ Sbjct: 72 DNSHCSFRGVRQRIWGKWVAEIREPK 97
>DRE1C_ARATH (Q9SYS6) Dehydration-responsive element-binding protein 1C (DREB1C| protein) (C-repeat-binding factor 2) (C-repeat/dehydration-responsive element-binding factor 2) (CRT/DRE-binding factor 2) Length = 216 Score = 43.5 bits (101), Expect = 3e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = +3 Query: 381 KHPVYRGVRMRAWGKWVSEIREPRK 455 +HP+YRGVR R GKWV E+REP K Sbjct: 47 RHPIYRGVRQRNSGKWVCELREPNK 71
>DRE1A_ARATH (Q9M0L0) Dehydration-responsive element-binding protein 1A (DREB1A| protein) (C-repeat-binding factor 3) (C-repeat/dehydration-responsive element-binding factor 3) (CRT/DRE-binding factor 3) Length = 216 Score = 43.5 bits (101), Expect = 3e-04 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = +3 Query: 381 KHPVYRGVRMRAWGKWVSEIREPRK 455 +HP+YRGVR R GKWV E+REP K Sbjct: 47 RHPIYRGVRRRNSGKWVCEVREPNK 71
>AP23_ARATH (P42736) AP2 domain transcription factor RAP2.3 (Related to AP2| protein 3) (Cadmium-induced protein AS30) Length = 248 Score = 43.1 bits (100), Expect = 4e-04 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = +3 Query: 390 VYRGVRMRAWGKWVSEIREPRK 455 VYRG+R R WGKW +EIR+PRK Sbjct: 78 VYRGIRKRPWGKWAAEIRDPRK 99
>DRE2E_ARATH (O80917) Dehydration-responsive element-binding protein 2E (DREB2E| protein) Length = 244 Score = 42.4 bits (98), Expect = 6e-04 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRKSRASGS 473 +RGVR R WGKWV+EIREP R + S Sbjct: 70 FRGVRQRVWGKWVAEIREPVSHRGANS 96
>DRE2D_ARATH (Q9LQZ2) Putative dehydration-responsive element-binding protein 2D| (DREB2D protein) Length = 206 Score = 41.6 bits (96), Expect = 0.001 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +3 Query: 375 DGKHPVYRGVRMRAWGKWVSEIREPRK 455 D Y+GVR R WGKWV+EIREP + Sbjct: 36 DNASCTYKGVRQRTWGKWVAEIREPNR 62
>DRE2C_ARATH (Q8LFR2) Dehydration-responsive element-binding protein 2C (DREB2C| protein) Length = 341 Score = 41.2 bits (95), Expect = 0.001 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREP 449 YRGVR R WGKWV+EIREP Sbjct: 72 YRGVRQRRWGKWVAEIREP 90
>DRE2G_ARATH (P61827) Dehydration-responsive element-binding protein 2G (DREB2G| protein) Length = 307 Score = 40.8 bits (94), Expect = 0.002 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRK 455 +RGVR R WGKWV+EIREP + Sbjct: 34 FRGVRQRTWGKWVAEIREPNR 54
>DRE2A_ARATH (O82132) Dehydration-responsive element-binding protein 2A (DREB2A| protein) Length = 335 Score = 40.4 bits (93), Expect = 0.002 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRK 455 +RGVR R WGKWV+EIREP + Sbjct: 79 FRGVRQRIWGKWVAEIREPNR 99
>DRE1F_ARATH (Q9LN86) Dehydration-responsive element-binding protein 1F (DREB1F| protein) Length = 209 Score = 40.4 bits (93), Expect = 0.002 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +3 Query: 381 KHPVYRGVRMRAWGKWVSEIREPRKSR 461 +HPVYRG+R R KWV E+REP R Sbjct: 26 RHPVYRGIRRRNGDKWVCEVREPTHQR 52
>ERF1A_ARATH (O80337) Ethylene-responsive transcription factor 1A| (Ethylene-responsive element-binding factor 1A) (EREBP-1A) (AtERF1) Length = 268 Score = 40.0 bits (92), Expect = 0.003 Identities = 18/32 (56%), Positives = 24/32 (75%) Frame = +3 Query: 369 SSDGKHPVYRGVRMRAWGKWVSEIREPRKSRA 464 ++ GKH YRGVR R WGK+ +EIR+P K+ A Sbjct: 142 AAKGKH--YRGVRQRPWGKFAAEIRDPAKNGA 171
>DRE1E_ARATH (Q9SGJ6) Dehydration-responsive element-binding protein 1E (DREB1E| protein) Length = 181 Score = 39.7 bits (91), Expect = 0.004 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +3 Query: 381 KHPVYRGVRMRAWGKWVSEIREPRKSR 461 +HP+YRGVR R KWV E+REP R Sbjct: 26 RHPIYRGVRRRDGDKWVCEVREPIHQR 52
>DRE2H_ARATH (Q9SIZ0) Putative dehydration-responsive element-binding protein 2H| (DREB2H protein) Length = 164 Score = 39.3 bits (90), Expect = 0.005 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREP 449 Y GVR R WGKWV+EIREP Sbjct: 74 YTGVRQRTWGKWVAEIREP 92
>ERF1_LYCES (Q84XB3) Ethylene-responsive transcription factor 1| (Ethylene-responsive element-binding factor 1) (EREBP-1) (ERF1-like protein) (LeERF1) Length = 244 Score = 38.5 bits (88), Expect = 0.009 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 378 GKHPVYRGVRMRAWGKWVSEIREPRKSRA 464 G+H YRGVR R WGK+ +EIR+P K+ A Sbjct: 104 GRH--YRGVRQRPWGKFAAEIRDPAKNGA 130
>ERF2_TOBAC (Q40479) Ethylene-responsive transcription factor 2| (Ethylene-responsive element-binding factor 2) (EREBP-2) (NtERF2) Length = 233 Score = 38.5 bits (88), Expect = 0.009 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 378 GKHPVYRGVRMRAWGKWVSEIREPRKSRA 464 G+H YRGVR R WGK+ +EIR+P K+ A Sbjct: 96 GRH--YRGVRQRPWGKFAAEIRDPAKNGA 122
>ERF2_NICSY (Q9LW50) Ethylene-responsive transcription factor 2| (Ethylene-responsive element-binding factor 2) (EREBP-2) (NsERF2) Length = 237 Score = 38.5 bits (88), Expect = 0.009 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 378 GKHPVYRGVRMRAWGKWVSEIREPRKSRA 464 G+H YRGVR R WGK+ +EIR+P K+ A Sbjct: 100 GRH--YRGVRQRPWGKFAAEIRDPAKNGA 126
>ERF13_ARATH (Q8L9K1) Ethylene-responsive transcription factor 13| (Ethylene-responsive element-binding factor 13) (EREBP-13) (AtERF13) Length = 226 Score = 38.1 bits (87), Expect = 0.012 Identities = 15/24 (62%), Positives = 20/24 (83%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRKSRA 464 YRGVR R WGK+ +EIR+P+K+ A Sbjct: 92 YRGVRRRPWGKFAAEIRDPKKNGA 115
>ERF1_TOBAC (Q40476) Ethylene-responsive transcription factor 1| (Ethylene-responsive element-binding factor 1) (EREBP-1) (NtERF1) Length = 236 Score = 38.1 bits (87), Expect = 0.012 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 378 GKHPVYRGVRMRAWGKWVSEIREPRKSRA 464 G+H YRGVR R WGK+ +EIR+P K+ A Sbjct: 102 GRH--YRGVRRRPWGKFAAEIRDPAKNGA 128
>ERF7_ARATH (Q9LDE4) Ethylene-responsive transcription factor 7| (Ethylene-responsive element-binding factor 7) (EREBP-7) (AtERF7) Length = 244 Score = 38.1 bits (87), Expect = 0.012 Identities = 17/28 (60%), Positives = 22/28 (78%), Gaps = 1/28 (3%) Frame = +3 Query: 381 KHPVYRGVRMRAWGKWVSEIREP-RKSR 461 K P YRGVR R WG++ +EIR+P +KSR Sbjct: 23 KEPRYRGVRKRPWGRFAAEIRDPLKKSR 50
>ERF2_ARATH (O80338) Ethylene-responsive transcription factor 2| (Ethylene-responsive element-binding factor 2) (EREBP-2) (AtERF2) Length = 243 Score = 37.4 bits (85), Expect = 0.021 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRKSRA 464 YRGVR R WGK+ +EIR+P K+ A Sbjct: 117 YRGVRQRPWGKFAAEIRDPAKNGA 140
>ERF11_ARATH (Q9C5I3) Ethylene-responsive transcription factor 11| (Ethylene-responsive element-binding factor 11) (EREBP-11) (AtERF11) Length = 166 Score = 37.0 bits (84), Expect = 0.027 Identities = 16/33 (48%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Frame = +3 Query: 366 RSSDGKHPVYRGVRMRAWGKWVSEIREP-RKSR 461 ++++G YRGVR R WG++ +EIR+P +KSR Sbjct: 11 KTNEGNGVRYRGVRKRPWGRYAAEIRDPFKKSR 43
>PTI6_LYCES (O04682) Pathogenesis-related genes transcriptional activator PTI6| (PTO-interacting protein 6) Length = 248 Score = 37.0 bits (84), Expect = 0.027 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRKSR 461 +RGVR R WG+W +EIR+P + + Sbjct: 98 FRGVRQRPWGRWAAEIRDPTRGK 120
>ERF6_ARATH (Q8VZ91) Ethylene-responsive transcription factor 6| (Ethylene-responsive element-binding factor 6) (EREBP-6) (AtERF6) Length = 282 Score = 37.0 bits (84), Expect = 0.027 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRK 455 YRGVRMR WGK+ +EIR+P + Sbjct: 137 YRGVRMRPWGKFAAEIRDPTR 157
>ERF5_ARATH (O80341) Ethylene-responsive transcription factor 5| (Ethylene-responsive element-binding factor 5) (EREBP-5) (AtERF5) Length = 300 Score = 36.6 bits (83), Expect = 0.035 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRK 455 YRGVR R WGK+ +EIR+P K Sbjct: 156 YRGVRQRPWGKFAAEIRDPNK 176
>ERF5_TOBAC (Q40478) Ethylene-responsive transcription factor 5| (Ethylene-responsive element-binding factor 5 homolog) (EREBP-4) (NtERF4) Length = 291 Score = 35.8 bits (81), Expect = 0.060 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +3 Query: 372 SDGKHPVYRGVRMRAWGKWVSEIREPRK 455 ++ KH YRGVR R WGK+ +EIR+P + Sbjct: 140 TEKKH--YRGVRQRPWGKFAAEIRDPNR 165
>ERF5_NICSY (Q9LW48) Ethylene-responsive transcription factor 5| (Ethylene-responsive element-binding factor 5 homolog) (EREBP-4) (NsERF4) Length = 282 Score = 35.8 bits (81), Expect = 0.060 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = +3 Query: 372 SDGKHPVYRGVRMRAWGKWVSEIREPRK 455 ++ KH YRGVR R WGK+ +EIR+P + Sbjct: 133 TEKKH--YRGVRQRPWGKFAAEIRDPNR 158
>ERF14_ARATH (P93822) Ethylene-responsive transcription factor 14| (Ethylene-responsive element-binding factor 14) (EREBP-14) (AtERF14) Length = 133 Score = 35.4 bits (80), Expect = 0.078 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRK 455 YRGVR R WGK+ +EIR+ RK Sbjct: 20 YRGVRRRPWGKYAAEIRDSRK 40
>ERF4_TOBAC (Q40477) Ethylene-responsive transcription factor 4| (Ethylene-responsive element-binding factor 4 homolog) (EREBP-3) (NtERF3) Length = 225 Score = 35.4 bits (80), Expect = 0.078 Identities = 18/32 (56%), Positives = 24/32 (75%), Gaps = 2/32 (6%) Frame = +3 Query: 372 SDGKHPV-YRGVRMRAWGKWVSEIREP-RKSR 461 +DG V YRGVR R WG++ +EIR+P +KSR Sbjct: 19 TDGVKEVHYRGVRKRPWGRYAAEIRDPGKKSR 50
>ERF4_NICSY (Q9LW49) Ethylene-responsive transcription factor 4| (Ethylene-responsive element-binding factor 4 homolog) (EREBP-3) (NsERF3) Length = 227 Score = 35.0 bits (79), Expect = 0.10 Identities = 15/24 (62%), Positives = 20/24 (83%), Gaps = 1/24 (4%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREP-RKSR 461 YRGVR R WG++ +EIR+P +KSR Sbjct: 27 YRGVRKRPWGRYAAEIRDPGKKSR 50
>ERF10_ARATH (Q9ZWA2) Ethylene-responsive transcription factor 10| (Ethylene-responsive element-binding factor 10) (EREBP-10) (AtERF10) Length = 245 Score = 35.0 bits (79), Expect = 0.10 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRKSR 461 YRGVR R WG++ +EIR+P K + Sbjct: 53 YRGVRRRPWGRYAAEIRDPVKKK 75
>ERF8_ARATH (Q9MAI5) Ethylene-responsive transcription factor 8| (Ethylene-responsive element-binding factor 8) (EREBP-8) (AtERF8) Length = 185 Score = 35.0 bits (79), Expect = 0.10 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +3 Query: 369 SSDGKHPVYRGVRMRAWGKWVSEIREPRK 455 S+ K YRGVR R WG++ +EIR+P K Sbjct: 23 SNAAKEIRYRGVRKRPWGRYAAEIRDPVK 51
>ERF4_ARATH (O80340) Ethylene-responsive transcription factor 4| (Ethylene-responsive element-binding factor 4) (Related to APETALA-2 protein 5) (EREBP-4) (AtERF4) Length = 222 Score = 35.0 bits (79), Expect = 0.10 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +3 Query: 372 SDGKHPVYRGVRMRAWGKWVSEIREPRK 455 ++ K YRGVR R WG++ +EIR+P K Sbjct: 18 NNAKEIRYRGVRKRPWGRYAAEIRDPGK 45
>ERF12_ARATH (Q94ID6) Ethylene-responsive transcription factor 12| (Ethylene-responsive element-binding factor 12) (EREBP-12) (AtERF12) Length = 189 Score = 34.3 bits (77), Expect = 0.17 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRK 455 YRGVR R WG++ +EIR+P K Sbjct: 12 YRGVRKRPWGRYAAEIRDPWK 32
>PZ02_LUPPO (P16146) Protein PPLZ02| Length = 164 Score = 33.5 bits (75), Expect = 0.30 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIR 443 YRG R R WG WVSEIR Sbjct: 8 YRGFRQRHWGSWVSEIR 24
>ERF3_TOBAC (Q9SXS8) Ethylene-responsive transcription factor 3| (Ethylene-responsive element-binding factor 3 homolog) (EREBP-5) (NtERF5) Length = 225 Score = 33.1 bits (74), Expect = 0.39 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +3 Query: 369 SSDGKHPVYRGVRMRAWGKWVSEIREPRK 455 S K +RGVR R WG++ +EIR+P K Sbjct: 20 SGGSKEIRFRGVRKRPWGRFAAEIRDPWK 48
>ERF9_ARATH (Q9FE67) Ethylene-responsive transcription factor 9| (Ethylene-responsive element-binding factor 9) (EREBP-9) (AtERF9) Length = 200 Score = 33.1 bits (74), Expect = 0.39 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRK 455 +RGVR R WG++ +EIR+P K Sbjct: 33 FRGVRKRPWGRYAAEIRDPGK 53
>PTI5_LYCES (O04681) Pathogenesis-related genes transcriptional activator PTI5| (PTO-interacting protein 5) Length = 161 Score = 32.3 bits (72), Expect = 0.66 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRKSRA 464 YRGVR R WGK+ +EIR+ + A Sbjct: 59 YRGVRRRPWGKYAAEIRDSARHGA 82
>ERF3_ARATH (O80339) Ethylene-responsive transcription factor 3| (Ethylene-responsive element-binding factor 3) (EREBP-3) (AtERF3) Length = 225 Score = 32.3 bits (72), Expect = 0.66 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRK 455 +RGVR R WG++ +EIR+P K Sbjct: 28 FRGVRKRPWGRFAAEIRDPWK 48
>ERF1B_ARATH (Q8LDC8) Ethylene-responsive transcription factor 1B| (Ethylene-responsive element-binding factor 1B) (EREBP-1B) (AtERF1) Length = 218 Score = 32.3 bits (72), Expect = 0.66 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = +3 Query: 369 SSDGKHPVYRGVRMRAWGKWVSEIREPRKS 458 SS YRGVR R WGK+ +EIR+ ++ Sbjct: 74 SSRKSEKSYRGVRRRPWGKFAAEIRDSTRN 103
>ERF15_ARATH (Q8VYM0) Ethylene-responsive transcription factor 15| (Ethylene-responsive element-binding factor 15) (EREBP-15) (AtERF15) Length = 243 Score = 32.0 bits (71), Expect = 0.87 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +3 Query: 393 YRGVRMRAWGKWVSEIREPRKS 458 YRGVR R WGK+ +EIR+ ++ Sbjct: 86 YRGVRKRPWGKFAAEIRDSTRN 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.124 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,503,797 Number of Sequences: 219361 Number of extensions: 380422 Number of successful extensions: 1801 Number of sequences better than 10.0: 44 Number of HSP's better than 10.0 without gapping: 1785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1801 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)
