| Clone Name | bast77d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | I17RA_HUMAN (Q96F46) Interleukin-17 receptor A precursor (IL-17 ... | 35 | 0.12 | 2 | ADEC2_RHIME (Q92VC6) Adenine deaminase 2 (EC 3.5.4.2) (Adenase 2... | 30 | 3.8 | 3 | GAL3_YEAST (P13045) Protein GAL3 | 29 | 8.5 |
|---|
>I17RA_HUMAN (Q96F46) Interleukin-17 receptor A precursor (IL-17 receptor)| Length = 866 Score = 35.0 bits (79), Expect = 0.12 Identities = 22/74 (29%), Positives = 31/74 (41%) Frame = +3 Query: 192 SFPHAVKQQCWEKAEKVPGRDPERWRRDALGNIVFRKLVGCPGCLCHDYDHILPYSKGGK 371 SFPH C+E +P PE + + + + R L GC C I P+ Sbjct: 236 SFPHMENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGC----CRHQVQIQPFF---S 288 Query: 372 STLENCQVLQATVN 413 S L +C ATV+ Sbjct: 289 SCLNDCLRHSATVS 302
>ADEC2_RHIME (Q92VC6) Adenine deaminase 2 (EC 3.5.4.2) (Adenase 2) (Adenine| aminase 2) Length = 593 Score = 30.0 bits (66), Expect = 3.8 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 2/55 (3%) Frame = +3 Query: 168 TPSASEPRSFPHAVKQQCWEKAE--KVPGRDPERWRRDALGNIVFRKLVGCPGCL 326 TP+ P V W+ E V G RW DA+G + R +V P C+ Sbjct: 98 TPAVYAAAVVPRGVTTVVWDPHEFGNVSGLAGVRWAVDAMGGLPLRAVVLAPSCV 152
>GAL3_YEAST (P13045) Protein GAL3| Length = 520 Score = 28.9 bits (63), Expect = 8.5 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 4/50 (8%) Frame = +3 Query: 363 GGKSTLENCQVLQATVNRSKGNNTEISKSELAQRSA----YCRVSGRDMD 500 GG S+ C AT+ + G N +ISK +L + +A Y V+ MD Sbjct: 160 GGLSSAFTCAAALATIRANMGKNFDISKKDLTRITAVAEHYVGVNNGGMD 209 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,547,156 Number of Sequences: 219361 Number of extensions: 1048542 Number of successful extensions: 3073 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3058 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3754426130 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)