| Clone Name | bast77d01 |
|---|---|
| Clone Library Name | barley_pub |
>NEP1_NEPGR (Q766C3) Aspartic proteinase nepenthesin-1 precursor (EC 3.4.23.-)| (Nepenthesin-I) Length = 437 Score = 48.9 bits (115), Expect = 7e-06 Identities = 23/53 (43%), Positives = 30/53 (56%) Frame = +1 Query: 250 GGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAGSFPVFHPK 408 G Y +LS+GTP QP ++DTGS L W C QC N S P+F+P+ Sbjct: 93 GEYLMNLSIGTPAQPFSAIMDTGSDLIWTQCQPCTQCFNQST-----PIFNPQ 140
>CATE_MOUSE (P70269) Cathepsin E precursor (EC 3.4.23.34)| Length = 397 Score = 43.1 bits (100), Expect = 4e-04 Identities = 24/53 (45%), Positives = 29/53 (54%), Gaps = 3/53 (5%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP---CTSNYQCQNCSAAAGSFPVFHP 405 Y ++S+GTPPQ V+ DTGS WVP CT S A + PVFHP Sbjct: 79 YFGTISIGTPPQNFTVIFDTGSSNLWVPSVYCT--------SPACKAHPVFHP 123
>CATE_CAVPO (P25796) Cathepsin E precursor (EC 3.4.23.34)| Length = 391 Score = 42.0 bits (97), Expect = 8e-04 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 3/71 (4%) Frame = +1 Query: 202 QAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP---CTSNYQCQNCS 372 Q+A+ P+ L +G ++S+G+PPQ V+ DTGS WVP CT S Sbjct: 60 QSANEPLINYLDMEYFG----TISIGSPPQNFTVIFDTGSSNLWVPSVYCT--------S 107 Query: 373 AAAGSFPVFHP 405 A + PVFHP Sbjct: 108 PACQTHPVFHP 118
>ASP3_CAEEL (P55956) Aspartic protease 3 precursor (EC 3.4.23.-)| Length = 398 Score = 40.8 bits (94), Expect = 0.002 Identities = 23/70 (32%), Positives = 33/70 (47%), Gaps = 15/70 (21%) Frame = +1 Query: 232 LYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCT------------SNYQCQ---N 366 L +S Y +++GTPPQ VL DTGS WVPC + + C+ + Sbjct: 61 LSDYSNAQYYGPVTIGTPPQNFQVLFDTGSSNLWVPCANCPFGDIACRMHNRFDCKKSSS 120 Query: 367 CSAAAGSFPV 396 C+A SF + Sbjct: 121 CTATGASFEI 130
>YPS3_YEAST (Q12303) Aspartic proteinase yapsin-3 precursor (EC 3.4.23.-)| Length = 508 Score = 40.0 bits (92), Expect = 0.003 Identities = 19/35 (54%), Positives = 22/35 (62%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQC 360 Y+ L++GTP Q L VLLDTGS WVP N C Sbjct: 63 YSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYC 97
>CHYM_SHEEP (P18276) Chymosin precursor (EC 3.4.23.4) (Preprorennin)| Length = 381 Score = 40.0 bits (92), Expect = 0.003 Identities = 26/59 (44%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Frame = +1 Query: 199 GQAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP---CTSNYQCQN 366 G+ AS P+ L +G + LGTPPQ VL DTGS WVP C SN C+N Sbjct: 59 GEVASVPLTNYLDSQYFG----KIYLGTPPQEFTVLFDTGSSDFWVPSIYCKSN-ACKN 112
>CHYM_BOVIN (P00794) Chymosin precursor (EC 3.4.23.4) (Preprorennin)| Length = 381 Score = 40.0 bits (92), Expect = 0.003 Identities = 26/59 (44%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Frame = +1 Query: 199 GQAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP---CTSNYQCQN 366 G+ AS P+ L +G + LGTPPQ VL DTGS WVP C SN C+N Sbjct: 59 GEVASVPLTNYLDSQYFG----KIYLGTPPQEFTVLFDTGSSDFWVPSIYCKSN-ACKN 112
>NAPSA_MOUSE (O09043) Napsin-A precursor (EC 3.4.23.-) (Kidney-derived aspartic| protease-like protein) (KDAP-1) (KAP) Length = 419 Score = 39.3 bits (90), Expect = 0.005 Identities = 22/51 (43%), Positives = 27/51 (52%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAGSFPVFHPK 408 Y ++ LGTPPQ V+ DTGS WVP T +C S A F+PK Sbjct: 73 YFGTIGLGTPPQNFTVVFDTGSSNLWVPST---RCHFFSLACWFHHRFNPK 120
>PEPC_MONDO (Q689Z7) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 391 Score = 38.9 bits (89), Expect = 0.007 Identities = 21/39 (53%), Positives = 23/39 (58%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCS 372 Y +S+GTPPQ VL DTGS WVP T Q Q CS Sbjct: 75 YFGEISIGTPPQNFLVLFDTGSSNLWVPST-YCQSQACS 112
>PEPC_CAVPO (Q64411) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 394 Score = 38.9 bits (89), Expect = 0.007 Identities = 20/36 (55%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +1 Query: 238 PHSY--GGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 P SY Y +SLGTPPQ VL DTGS WVP Sbjct: 71 PMSYMDAAYFGQISLGTPPQSFQVLFDTGSSNLWVP 106
>ASPP_AEDAE (Q03168) Lysosomal aspartic protease precursor (EC 3.4.23.-)| Length = 387 Score = 38.9 bits (89), Expect = 0.007 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +1 Query: 205 AASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 A S PV L + Y ++++GTPPQ V+ DTGS WVP Sbjct: 51 AVSGPVPEPLSNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVP 95
>PEPB_CANFA (Q8SQ41) Pepsin B precursor (EC 3.4.23.2)| Length = 390 Score = 38.9 bits (89), Expect = 0.007 Identities = 23/46 (50%), Positives = 26/46 (56%) Frame = +1 Query: 235 YPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCS 372 Y SY Y +S+GTPPQ +L DTGS WVP T Q Q CS Sbjct: 69 YLDSY--YFGEISIGTPPQNFLILFDTGSSNLWVPST-YCQSQACS 111
>MKC7_YEAST (P53379) Aspartic proteinase MKC7 precursor (EC 3.4.23.41) (Yapsin| 2) Length = 596 Score = 38.9 bits (89), Expect = 0.007 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQC 360 Y+ L +GTPPQ + VL+DTGS WV + N C Sbjct: 81 YSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYC 115
>CARP_RHIPU (P09177) Mucorpepsin precursor (EC 3.4.23.23) (Mucor rennin)| Length = 427 Score = 38.9 bits (89), Expect = 0.007 Identities = 21/51 (41%), Positives = 25/51 (49%) Frame = +1 Query: 232 LYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAG 384 LY YA +S+GTP Q +L DTGS TWVP + C N G Sbjct: 78 LYDFDLEEYAIPVSIGTPGQDFYLLFDTGSSDTWVP---HKGCDNSEGCVG 125
>CARP_RHIMI (P00799) Mucorpepsin precursor (EC 3.4.23.23) (Mucor rennin)| Length = 430 Score = 38.5 bits (88), Expect = 0.009 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP---CTSNYQC 360 YA +S+GTP Q +L DTGS TWVP CT + C Sbjct: 89 YAIPVSIGTPGQDFLLLFDTGSSDTWVPHKGCTKSEGC 126
>PAG2_BOVIN (Q28057) Pregnancy-associated glycoprotein 2 precursor (EC| 3.4.23.-) (PAG 2) Length = 376 Score = 38.5 bits (88), Expect = 0.009 Identities = 15/29 (51%), Positives = 20/29 (68%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPC 342 Y ++++GTPPQ V+ DTGS WVPC Sbjct: 68 YVGNITIGTPPQEFRVVFDTGSANLWVPC 96
>PEPE_CHICK (P16476) Embryonic pepsinogen precursor (EC 3.4.23.-)| Length = 383 Score = 38.5 bits (88), Expect = 0.009 Identities = 22/50 (44%), Positives = 28/50 (56%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAGSFPVFHP 405 Y ++S+GTPPQ V+ DTGS WVP S C S A S +F+P Sbjct: 76 YYGTISIGTPPQDFTVVFDTGSSNLWVPSVS---C--TSPACQSHQMFNP 120
>CATE_RANCA (Q800A0) Cathepsin E precursor (EC 3.4.23.34)| Length = 397 Score = 38.5 bits (88), Expect = 0.009 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Frame = +1 Query: 202 QAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP---CTS 348 + AS P+ L +G +S+GTPPQ V+ DTGS WVP CTS Sbjct: 60 ETASEPLMNYLDVEYFG----QISIGTPPQQFTVIFDTGSSNLWVPSIYCTS 107
>NEP2_NEPGR (Q766C2) Aspartic proteinase nepenthesin-2 precursor (EC 3.4.23.-)| (Nepenthesin-II) Length = 438 Score = 38.5 bits (88), Expect = 0.009 Identities = 20/67 (29%), Positives = 33/67 (49%) Frame = +1 Query: 208 ASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAGS 387 +SS + +Y G Y ++++GTP ++DTGS L W C QC + Sbjct: 81 SSSGIETPVYAGD-GEYLMNVAIGTPDSSFSAIMDTGSDLIWTQCEPCTQC-----FSQP 134 Query: 388 FPVFHPK 408 P+F+P+ Sbjct: 135 TPIFNPQ 141
>YPS1_YEAST (P32329) Aspartic proteinase 3 precursor (EC 3.4.23.41) (Yapsin-1)| Length = 569 Score = 38.1 bits (87), Expect = 0.012 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCS 372 Y+ L +GTPPQ + VL+DTGS W+ + N C + S Sbjct: 83 YSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNS 121
>PEPA4_RABIT (P28713) Pepsin II-4 precursor (EC 3.4.23.1) (Pepsin A)| Length = 387 Score = 38.1 bits (87), Expect = 0.012 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT 345 Y ++S+GTPPQ V+ DTGS WVP T Sbjct: 75 YFGTISIGTPPQDFTVIFDTGSSNLWVPST 104
>PEPA2_RABIT (P27821) Pepsin II-2/3 precursor (EC 3.4.23.1) (Pepsin A)| Length = 387 Score = 38.1 bits (87), Expect = 0.012 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT 345 Y ++S+GTPPQ V+ DTGS WVP T Sbjct: 75 YFGTISIGTPPQDFTVIFDTGSSNLWVPST 104
>PEPA1_RABIT (P28712) Pepsin II-1 precursor (EC 3.4.23.1) (Pepsin A)| Length = 387 Score = 38.1 bits (87), Expect = 0.012 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT 345 Y ++S+GTPPQ V+ DTGS WVP T Sbjct: 75 YFGTISIGTPPQEFTVIFDTGSSNLWVPST 104
>PEPAF_RABIT (P27823) Pepsin F precursor (EC 3.4.23.1)| Length = 388 Score = 38.1 bits (87), Expect = 0.012 Identities = 22/50 (44%), Positives = 27/50 (54%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAGSFPVFHP 405 Y +S+GTPPQ V+LDTGS WVP + C S A G F+P Sbjct: 74 YIGIISIGTPPQEFKVVLDTGSADLWVP---SIYCS--SPACGKHNTFNP 118
>CATE_RAT (P16228) Cathepsin E precursor (EC 3.4.23.34)| Length = 398 Score = 38.1 bits (87), Expect = 0.012 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 3/53 (5%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP---CTSNYQCQNCSAAAGSFPVFHP 405 Y ++S+G+P Q V+ DTGS WVP CT S A + PVFHP Sbjct: 80 YFGTVSIGSPSQNFTVIFDTGSSNLWVPSVYCT--------SPACKAHPVFHP 124
>RENI2_MOUSE (P00796) Renin-2 precursor (EC 3.4.23.15) (Angiotensinogenase)| (Submandibular gland renin) [Contains: Renin-2 heavy chain; Renin-2 light chain] Length = 401 Score = 37.7 bits (86), Expect = 0.016 Identities = 23/57 (40%), Positives = 28/57 (49%) Frame = +1 Query: 214 SPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAG 384 SPV Y +S Y + +GTPPQ V+ DTGS WVP T +C A G Sbjct: 71 SPVVLTNYLNSQ--YYGEIGIGTPPQTFKVIFDTGSANLWVPST---KCSRLYLACG 122
>PEPC_MACFU (P03955) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| (Fragment) Length = 377 Score = 37.7 bits (86), Expect = 0.016 Identities = 28/72 (38%), Positives = 35/72 (48%) Frame = +1 Query: 190 HHQGQAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNC 369 +H G + S A +Y G +S+GTPPQ VL DTGS WVP + CQ Sbjct: 43 YHFGDLSVSYEPMAYMDAAYFG---EISIGTPPQNFLVLFDTGSSNLWVP---SVYCQ-- 94 Query: 370 SAAAGSFPVFHP 405 S A S F+P Sbjct: 95 SQACTSHSRFNP 106
>NEP1_NEPDI (P69476) Aspartic proteinase nepenthesin-1 (EC 3.4.23.-)| (Nepenthesin-I) (Fragments) Length = 164 Score = 37.7 bits (86), Expect = 0.016 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +1 Query: 250 GGYAFSLSLGTPPQPLPVLLDTGSHLTW 333 G Y LS+GTP QP ++DTGS L W Sbjct: 15 GEYLMXLSIGTPAQPFSAIMDTGSDLIW 42
>CARPV_CANAL (P10977) Vacuolar aspartic protease precursor (EC 3.4.23.-)| (Aspartate protease) (ACP) Length = 419 Score = 37.7 bits (86), Expect = 0.016 Identities = 18/34 (52%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP---CTS 348 Y + +GTP QP V+LDTGS WVP CTS Sbjct: 104 YFTEIQIGTPGQPFKVILDTGSSNLWVPSQDCTS 137
>PEPC_HUMAN (P20142) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 388 Score = 37.4 bits (85), Expect = 0.021 Identities = 23/50 (46%), Positives = 27/50 (54%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAGSFPVFHP 405 Y +S+GTPPQ VL DTGS WVP + CQ S A S F+P Sbjct: 73 YFGEISIGTPPQNFLVLFDTGSSNLWVP---SVYCQ--SQACTSHSRFNP 117
>PEPC_CALJA (Q9N2D3) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 388 Score = 37.4 bits (85), Expect = 0.021 Identities = 23/50 (46%), Positives = 27/50 (54%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAGSFPVFHP 405 Y +S+GTPPQ VL DTGS WVP + CQ S A S F+P Sbjct: 73 YFGEISIGTPPQNFLVLFDTGSSNLWVP---SVYCQ--SQACTSHSRFNP 117
>CARP_YEAST (P07267) Saccharopepsin precursor (EC 3.4.23.25) (Aspartate| protease) (Proteinase A) (Proteinase YSCA) Length = 405 Score = 37.4 bits (85), Expect = 0.021 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y ++LGTPPQ V+LDTGS WVP Sbjct: 91 YYTDITLGTPPQNFKVILDTGSSNLWVP 118
>BAR1_YEAST (P12630) Barrierpepsin precursor (EC 3.4.23.35) (Extracellular| "barrier" protein) (BAR proteinase) Length = 587 Score = 37.4 bits (85), Expect = 0.021 Identities = 19/35 (54%), Positives = 22/35 (62%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQC 360 YA +L +GTP Q L VL DTGS WV +SN C Sbjct: 45 YATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFC 79
>PEPA_SORUN (Q9GMY8) Pepsin A precursor (EC 3.4.23.1)| Length = 387 Score = 37.0 bits (84), Expect = 0.027 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPC--TSNYQCQN 366 Y ++S+GTPPQ V+ DTGS WVP S+ C N Sbjct: 75 YFGTISIGTPPQEFTVIFDTGSSNLWVPSIYCSSPACSN 113
>RENI1_MOUSE (P06281) Renin-1 precursor (EC 3.4.23.15) (Angiotensinogenase)| (Kidney renin) Length = 402 Score = 37.0 bits (84), Expect = 0.027 Identities = 22/58 (37%), Positives = 29/58 (50%) Frame = +1 Query: 211 SSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAG 384 +SPV Y ++ Y + +GTPPQ V+ DTGS WVP T +C A G Sbjct: 71 TSPVVLTNYLNTQ--YYGEIGIGTPPQTFKVIFDTGSANLWVPST---KCSRLYLACG 123
>PEPC_SUNMU (P81498) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C-1)| Length = 389 Score = 37.0 bits (84), Expect = 0.027 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +1 Query: 229 ALYPHSY--GGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAA 381 A P +Y Y +S+GTPPQ VL DTGS WVP + Q Q C+ A Sbjct: 62 AYEPMAYMDASYFGEISIGTPPQNFLVLFDTGSSNLWVP-SVYCQSQACTGHA 113
>PEPC_SORUN (Q9GMY4) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 389 Score = 37.0 bits (84), Expect = 0.027 Identities = 23/53 (43%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = +1 Query: 229 ALYPHSY--GGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAA 381 A P +Y Y +S+GTPPQ VL DTGS WVP + Q Q C+ A Sbjct: 62 AYEPMAYLDAAYFGEISIGTPPQNFLVLFDTGSSNLWVP-SVYCQSQACTGHA 113
>ASP1_ORYSA (Q6YNY7) Aspartic proteinase Asp1 precursor (EC 3.4.23.-) (OsAsp1)| (Nucellin-like protein) Length = 410 Score = 37.0 bits (84), Expect = 0.027 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 2/56 (3%) Frame = +1 Query: 211 SSPVRAALYPHSY--GGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCS 372 SS V L+ + Y G + ++++ P +P + +DTGS LTW+ C +Y C NC+ Sbjct: 21 SSAVVLELHGNVYPIGHFFVTMNISDPAKPYFLDIDTGSTLTWLQC--DYPCINCN 74
>CYPR1_CYNCA (P40782) Cyprosin precursor (EC 3.4.23.-) (Fragment)| Length = 473 Score = 36.6 bits (83), Expect = 0.035 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNC 369 Y + +GTPPQ V+ DTGS WVP + Y C Sbjct: 51 YFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVAC 88
>PAG2_PIG (Q29079) Pregnancy-associated glycoprotein 2 precursor (EC| 3.4.23.-) (PAG 2) Length = 420 Score = 36.6 bits (83), Expect = 0.035 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y ++S+GTPPQ V+ DTGS WVP Sbjct: 76 YVGNISIGTPPQQFSVVFDTGSSDLWVP 103
>CARP_NEUCR (Q01294) Vacuolar protease A precursor (EC 3.4.23.-)| Length = 396 Score = 36.6 bits (83), Expect = 0.035 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y +++GTPPQ V+LDTGS WVP Sbjct: 85 YFSEITIGTPPQTFKVVLDTGSSNLWVP 112
>CATE_HUMAN (P14091) Cathepsin E precursor (EC 3.4.23.34)| Length = 401 Score = 36.2 bits (82), Expect = 0.046 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 3/34 (8%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP---CTS 348 Y ++S+G+PPQ V+ DTGS WVP CTS Sbjct: 78 YFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTS 111
>PEPC_RHIFE (Q9GMY3) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 389 Score = 36.2 bits (82), Expect = 0.046 Identities = 19/39 (48%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 229 ALYPHSY--GGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 A P +Y Y +S+GTPPQ VL DTGS WVP Sbjct: 62 AYEPMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVP 100
>PEPA_RHIFE (Q9GMY7) Pepsin A precursor (EC 3.4.23.1)| Length = 386 Score = 36.2 bits (82), Expect = 0.046 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +1 Query: 202 QAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCT--SNYQCQN 366 +AAS L + Y ++ +GTPPQ V+ DTGS WVP S+ C N Sbjct: 56 EAASMMATQPLENYMDMEYFGTIGIGTPPQEFTVIFDTGSSNLWVPSVYCSSPACSN 112
>ASPR_HORVU (P42210) Phytepsin precursor (EC 3.4.23.40) (Aspartic proteinase)| [Contains: Phytepsin 32 kDa subunit; Phytepsin 29 kDa subunit; Phytepsin 16 kDa subunit; Phytepsin 11 kDa subunit] Length = 508 Score = 35.8 bits (81), Expect = 0.060 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +1 Query: 229 ALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNY 354 AL + Y + +GTPPQ V+ DTGS WVP Y Sbjct: 75 ALKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCY 116
>ASPRX_ORYSA (P42211) Aspartic proteinase precursor (EC 3.4.23.-)| Length = 496 Score = 35.8 bits (81), Expect = 0.060 Identities = 20/52 (38%), Positives = 26/52 (50%) Frame = +1 Query: 199 GQAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNY 354 G + S PV Y ++ Y + LG+PPQ V+ DTGS WVP Y Sbjct: 60 GSSDSDPVPLVDYLNTQ--YYGVIGLGSPPQNFTVIFDTGSSNLWVPSAKCY 109
>ASPR1_ORYSA (Q42456) Aspartic proteinase oryzasin-1 precursor (EC 3.4.23.-)| Length = 509 Score = 35.8 bits (81), Expect = 0.060 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +1 Query: 229 ALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNY 354 AL + Y + +GTPPQ V+ DTGS WVP Y Sbjct: 76 ALKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCY 117
>PEPA_SUNMU (P81497) Pepsin A precursor (EC 3.4.23.1)| Length = 387 Score = 35.8 bits (81), Expect = 0.060 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT--SNYQCQN 366 Y ++ +GTPPQ V+ DTGS WVP S+ C N Sbjct: 75 YFGTIGIGTPPQEFTVIFDTGSSNLWVPSVYCSSPACSN 113
>CATEB_XENLA (Q805F2) Cathepsin E-B precursor (EC 3.4.23.34)| Length = 397 Score = 35.8 bits (81), Expect = 0.060 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y +S+GTPPQ V+ DTGS WVP Sbjct: 74 YFGEISIGTPPQNFTVIFDTGSSNLWVP 101
>PEPA_CANFA (Q9GMY6) Pepsin A precursor (EC 3.4.23.1)| Length = 386 Score = 35.8 bits (81), Expect = 0.060 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT--SNYQCQN 366 Y ++ +GTPPQ V+ DTGS WVP S+ C N Sbjct: 74 YFGTIGIGTPPQEFTVIFDTGSSNLWVPSVYCSSPACSN 112
>RENI_SHEEP (P52115) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 400 Score = 35.8 bits (81), Expect = 0.060 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT 345 Y + +GTPPQ V+ DTGS WVP T Sbjct: 80 YYGEIGIGTPPQTFKVIFDTGSANLWVPST 109
>PEPA_CALJA (Q9N2D4) Pepsin A precursor (EC 3.4.23.1)| Length = 387 Score = 35.4 bits (80), Expect = 0.078 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +1 Query: 196 QGQAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 QG+AA+ L + Y ++ +GTP Q V+ DTGS WVP Sbjct: 55 QGEAATMIANQPLVNYLDMEYFGTIGIGTPAQEFTVIFDTGSSNLWVP 102
>CHYM_CALJA (Q9N2D2) Chymosin precursor (EC 3.4.23.4) (Preprorennin)| Length = 381 Score = 35.4 bits (80), Expect = 0.078 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT--SNYQCQN 366 Y + +GTPPQ V+ DTGS WVP ++ CQN Sbjct: 74 YFGKIYIGTPPQEFTVVFDTGSSDLWVPSVYCNSVACQN 112
>CATEA_XENLA (Q805F3) Cathepsin E-A precursor (EC 3.4.23.34)| Length = 397 Score = 35.4 bits (80), Expect = 0.078 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y +S+GTPPQ V+ DTGS WVP Sbjct: 74 YFGEISVGTPPQNFTVIFDTGSSNLWVP 101
>RENI_CANFA (Q6DYE7) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 403 Score = 35.4 bits (80), Expect = 0.078 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT 345 Y + +GTPPQ V+ DTGS WVP T Sbjct: 85 YYGEIGIGTPPQTFKVVFDTGSANLWVPST 114
>PAG_HORSE (Q28389) Pregnancy-associated glycoprotein precursor (EC 3.4.23.-)| (PAG) Length = 388 Score = 35.4 bits (80), Expect = 0.078 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 15/60 (25%) Frame = +1 Query: 232 LYPHSYGGYAFS-------------LSLGTPPQPLPVLLDTGSHLTWVPC--TSNYQCQN 366 L+ H+ G AF +S+GTPPQ V+ DTGS WVP S+ C N Sbjct: 53 LHKHADSGVAFEPMRNYLDIAYMGIISVGTPPQEFQVIFDTGSADLWVPSIYCSSPACSN 112
>CATD_MOUSE (P18242) Cathepsin D precursor (EC 3.4.23.5)| Length = 410 Score = 35.0 bits (79), Expect = 0.10 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +1 Query: 211 SSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 + PV L + Y + +GTPPQ V+ DTGS WVP Sbjct: 64 TEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVP 106
>PEPC_RAT (P04073) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 392 Score = 35.0 bits (79), Expect = 0.10 Identities = 22/50 (44%), Positives = 27/50 (54%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAGSFPVFHP 405 Y +S+GTPPQ VL DTGS WV S+ CQ S A + F+P Sbjct: 76 YFGEISIGTPPQNFLVLFDTGSSNLWV---SSVYCQ--SEACTTHARFNP 120
>PEPC_MOUSE (Q9D7R7) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 392 Score = 35.0 bits (79), Expect = 0.10 Identities = 21/59 (35%), Positives = 28/59 (47%) Frame = +1 Query: 190 HHQGQAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQN 366 +H G+ V + Y +S+GTPPQ VL DTGS WV S+ CQ+ Sbjct: 54 YHFGKFGDYSVLYEPMAYMDASYYGEISIGTPPQNFLVLFDTGSSNLWV---SSVYCQS 109
>RENI_PANTR (P60016) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 406 Score = 34.7 bits (78), Expect = 0.13 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y + +GTPPQ V+ DTGS WVP Sbjct: 86 YYGEIGIGTPPQTFKVVFDTGSSNVWVP 113
>RENI_MACMU (Q6DLW5) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 406 Score = 34.7 bits (78), Expect = 0.13 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y + +GTPPQ V+ DTGS WVP Sbjct: 86 YYGEIGIGTPPQTFKVVFDTGSSNVWVP 113
>RENI_MACFA (Q6DLS0) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 406 Score = 34.7 bits (78), Expect = 0.13 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y + +GTPPQ V+ DTGS WVP Sbjct: 86 YYGEIGIGTPPQTFKVVFDTGSSNVWVP 113
>RENI_HUMAN (P00797) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 406 Score = 34.7 bits (78), Expect = 0.13 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y + +GTPPQ V+ DTGS WVP Sbjct: 86 YYGEIGIGTPPQTFKVVFDTGSSNVWVP 113
>CATD_HUMAN (P07339) Cathepsin D precursor (EC 3.4.23.5) [Contains: Cathepsin D| light chain; Cathepsin D heavy chain] Length = 412 Score = 34.7 bits (78), Expect = 0.13 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 217 PVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 P+ L + Y + +GTPPQ V+ DTGS WVP Sbjct: 66 PIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVP 106
>CATD_RAT (P24268) Cathepsin D precursor (EC 3.4.23.5) [Contains: Cathepsin D| 12 kDa light chain; Cathepsin D 9 kDa light chain; Cathepsin D 34 kDa heavy chain; Cathepsin D 30 kDa heavy chain] Length = 407 Score = 34.7 bits (78), Expect = 0.13 Identities = 17/41 (41%), Positives = 21/41 (51%) Frame = +1 Query: 217 PVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 PV L + Y + +GTPPQ V+ DTGS WVP Sbjct: 66 PVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVP 106
>RENI_CALJA (Q9TSZ1) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 400 Score = 34.7 bits (78), Expect = 0.13 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y + +GTPPQ V+ DTGS WVP Sbjct: 80 YYGEIGIGTPPQTFKVVFDTGSSNVWVP 107
>CATD_PIG (P00795) Cathepsin D precursor (EC 3.4.23.5) [Contains: Cathepsin D| light chain; Cathepsin D heavy chain] Length = 345 Score = 34.7 bits (78), Expect = 0.13 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 217 PVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 P+ L + Y + +GTPPQ V+ DTGS WVP Sbjct: 2 PIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVP 42
>ASPR_CUCPE (O04057) Aspartic proteinase precursor (EC 3.4.23.-)| Length = 513 Score = 34.7 bits (78), Expect = 0.13 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPC 342 Y +++GTPPQ V+ DTGS WV C Sbjct: 90 YYGEIAIGTPPQKFTVIFDTGSSNLWVLC 118
>PEP2B_GADMO (P56272) Pepsin IIB (EC 3.4.23.-)| Length = 324 Score = 34.3 bits (77), Expect = 0.17 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +1 Query: 268 LSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCS 372 +S+GTPP+ V+ DTGS WV +S+ Q CS Sbjct: 18 ISIGTPPESFKVIFDTGSSNLWV-SSSHCSAQACS 51
>PAG1_BOVIN (Q29432) Pregnancy-associated glycoprotein 1 precursor (EC| 3.4.23.-) (PAG 1) (Pregnancy-specific protein B) (PSP-B) Length = 380 Score = 34.3 bits (77), Expect = 0.17 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP---CTS 348 Y ++++GTPPQ V+ DT S WVP CTS Sbjct: 71 YMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTS 104
>CARP7_CANAL (P43096) Candidapepsin-7 precursor (EC 3.4.23.24) (Aspartate| protease 7) (ACP 7) (Secreted aspartic protease 7) Length = 588 Score = 34.3 bits (77), Expect = 0.17 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQ 363 Y +L +G+P Q + V++DTGS W + N QC+ Sbjct: 226 YTATLKVGSPAQEVQVMIDTGSSDLWFISSGNSQCK 261
>CATD_CLUHA (Q9DEX3) Cathepsin D precursor (EC 3.4.23.5)| Length = 396 Score = 34.3 bits (77), Expect = 0.17 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +1 Query: 190 HHQG-QAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 H+QG ++++P L + Y + LGTP Q V+ DTGS W+P Sbjct: 53 HNQGFPSSNAPTPETLKNYMDAQYYGEIGLGTPVQMFTVVFDTGSSNLWLP 103
>CATD_CANFA (Q4LAL9) Cathepsin D precursor (EC 3.4.23.5)| Length = 410 Score = 34.3 bits (77), Expect = 0.17 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 217 PVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 P+ L + Y + +GTPPQ V+ DTGS WVP Sbjct: 66 PIPEMLRNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVP 106
>CATD_CHICK (Q05744) Cathepsin D precursor (EC 3.4.23.5) [Contains: Cathepsin D| light chain; Cathepsin D heavy chain] Length = 398 Score = 34.3 bits (77), Expect = 0.17 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y + +GTPPQ V+ DTGS WVP Sbjct: 78 YYGEIGIGTPPQKFTVVFDTGSSNLWVP 105
>CATD_BOVIN (P80209) Cathepsin D precursor (EC 3.4.23.5)| Length = 390 Score = 33.9 bits (76), Expect = 0.23 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 217 PVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 P+ L + Y + +GTPPQ V+ DTGS WVP Sbjct: 46 PIPELLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSANLWVP 86
>CARP_SACFI (P22929) Acid protease precursor (EC 3.4.23.-)| Length = 390 Score = 33.9 bits (76), Expect = 0.23 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = +1 Query: 202 QAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 +AAS + Y Y ++ +GTP Q L V +DTGS WVP Sbjct: 57 RAASDAGVTISLENEYSFYLTTIEIGTPGQKLQVDVDTGSSDLWVP 102
>NAPSA_HUMAN (O96009) Napsin-A precursor (EC 3.4.23.-) (Napsin-1) (NAPA)| (TA01/TA02) (Aspartyl protease 4) (Asp 4) (ASP4) Length = 420 Score = 33.9 bits (76), Expect = 0.23 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y + LGTPPQ V DTGS WVP Sbjct: 78 YFGEIGLGTPPQNFTVAFDTGSSNLWVP 105
>PEPA_CHICK (P00793) Pepsin A precursor (EC 3.4.23.1)| Length = 367 Score = 33.9 bits (76), Expect = 0.23 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP---CTSNYQCQN 366 Y ++S+GTP Q V+ DTGS WVP C S+ C N Sbjct: 59 YYGTISIGTPQQDFSVIFDTGSSNLWVPSIYCKSS-ACSN 97
>CATD_SHEEP (Q9MZS8) Cathepsin D precursor (EC 3.4.23.5) (Fragment)| Length = 365 Score = 33.9 bits (76), Expect = 0.23 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +1 Query: 217 PVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 P+ L + Y + +GTPPQ V+ DTGS WVP Sbjct: 41 PIPELLTNYMDAQYYGEIGIGTPPQCFTVVFDTGSANLWVP 81
>BACE2_HUMAN (Q9Y5Z0) Beta-secretase 2 precursor (EC 3.4.23.45) (Beta-site| APP-cleaving enzyme 2) (Aspartyl protease 1) (Asp 1) (ASP1) (Membrane-associated aspartic protease 1) (Memapsin-1) (Down region aspartic protease) Length = 518 Score = 33.5 bits (75), Expect = 0.30 Identities = 20/47 (42%), Positives = 25/47 (53%), Gaps = 8/47 (17%) Frame = +1 Query: 205 AASSPVRAA--------LYPHSYGGYAFSLSLGTPPQPLPVLLDTGS 321 A +SP AA L S GY + +GTPPQ L +L+DTGS Sbjct: 67 ALASPAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGS 113
>CARP3_CANAL (P43092) Candidapepsin-3 precursor (EC 3.4.23.24) (Aspartate| protease 3) (ACP 3) (Secreted aspartic protease 3) Length = 398 Score = 33.5 bits (75), Expect = 0.30 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAGSFPVF 399 YA +++G+ Q L V++DTGS WVP + +C A G P F Sbjct: 72 YASDITVGSNKQKLTVVIDTGSSDLWVPDSQ----VSCQAGQGQDPNF 115
>PEPA3_RABIT (P27822) Pepsin-3 precursor (EC 3.4.23.1) (Pepsin III) (Pepsin A)| Length = 387 Score = 33.1 bits (74), Expect = 0.39 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAGS 387 Y ++ +GTP Q V+ DTGS WVP CS+AA S Sbjct: 75 YFGTIGIGTPAQDFTVIFDTGSSNLWVPSV------YCSSAACS 112
>CATE_RABIT (P43159) Cathepsin E precursor (EC 3.4.23.34)| Length = 396 Score = 33.1 bits (74), Expect = 0.39 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Frame = +1 Query: 202 QAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVP---CTS 348 Q+A+ P+ L +G ++S+G+PPQ V+ DT S WVP CTS Sbjct: 64 QSANEPLINYLDMEYFG----TISIGSPPQNFTVIFDTVSSNLWVPSVYCTS 111
>PEPA_MACMU (P11489) Pepsin A precursor (EC 3.4.23.1)| Length = 388 Score = 33.1 bits (74), Expect = 0.39 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT--SNYQCQN 366 Y ++ +GTP Q V+ DTGS WVP S+ C N Sbjct: 76 YFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACTN 114
>PEPA2_MACFU (P27677) Pepsin A-2/A-3 precursor (EC 3.4.23.1) (Pepsin| III-2/III-1) Length = 388 Score = 33.1 bits (74), Expect = 0.39 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT--SNYQCQN 366 Y ++ +GTP Q V+ DTGS WVP S+ C N Sbjct: 76 YFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACTN 114
>PEPA1_MACFU (P03954) Pepsin A-1 precursor (EC 3.4.23.1) (Pepsin III-3)| Length = 388 Score = 33.1 bits (74), Expect = 0.39 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT--SNYQCQN 366 Y ++ +GTP Q V+ DTGS WVP S+ C N Sbjct: 76 YFGTIGIGTPAQDFTVIFDTGSSNLWVPSVYCSSLACTN 114
>RENI_RAT (P08424) Renin precursor (EC 3.4.23.15) (Angiotensinogenase)| Length = 402 Score = 32.7 bits (73), Expect = 0.51 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT 345 Y + +GTP Q V+ DTGS WVP T Sbjct: 84 YYGEIGIGTPSQTFKVIFDTGSANLWVPST 113
>PAG1_PIG (Q29078) Pregnancy-associated glycoprotein 1 precursor (EC| 3.4.23.-) (PAG 1) Length = 389 Score = 32.7 bits (73), Expect = 0.51 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y ++++GTPPQ V+ DT S WVP Sbjct: 76 YVGNITIGTPPQLFSVIFDTASSDLWVP 103
>PEPC_RABIT (Q9GMY2) Gastricsin precursor (EC 3.4.23.3) (Pepsinogen C)| Length = 388 Score = 32.7 bits (73), Expect = 0.51 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y +S+GTP Q VL DTGS WVP Sbjct: 73 YFGEISIGTPSQNFLVLFDTGSSNLWVP 100
>PEPA_HUMAN (P00790) Pepsin A precursor (EC 3.4.23.1)| Length = 388 Score = 32.7 bits (73), Expect = 0.51 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCT--SNYQCQN 366 Y ++ +GTP Q V+ DTGS WVP S+ C N Sbjct: 76 YFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTN 114
>PEPA_BOVIN (P00792) Pepsin A precursor (EC 3.4.23.1)| Length = 372 Score = 32.3 bits (72), Expect = 0.66 Identities = 16/39 (41%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPC--TSNYQCQN 366 Y ++ +GTP Q V+ DTGS WVP S+ C N Sbjct: 60 YFGTIGIGTPAQDFTVIFDTGSSNLWVPSIYCSSEACTN 98
>PEPA_PIG (P00791) Pepsin A precursor (EC 3.4.23.1)| Length = 386 Score = 32.0 bits (71), Expect = 0.87 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y ++ +GTP Q V+ DTGS WVP Sbjct: 73 YFGTIGIGTPAQDFTVIFDTGSSNLWVP 100
>PEPA4_MACFU (P27678) Pepsin A-4 precursor (EC 3.4.23.1) (Pepsin I/II)| Length = 388 Score = 32.0 bits (71), Expect = 0.87 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAAAGSFPVFHPK 408 Y ++ +GTP Q V+ DTGS WVP Y S A +F+P+ Sbjct: 76 YFGTIGIGTPAQNFTVVFDTGSSNLWVPSVYCY-----SLACMDHNLFNPQ 121
>CARP_PODAN (O13340) Podosporapepsin precursor (EC 3.4.23.-)| Length = 425 Score = 32.0 bits (71), Expect = 0.87 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = +1 Query: 199 GQAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWV 336 G AA+ P+ Y +++GTPPQ L + LDTGS WV Sbjct: 94 GSAAAIPINEVDI-----AYVTPVTIGTPPQTLMLDLDTGSSDLWV 134
>BACE1_RAT (P56819) Beta-secretase 1 precursor (EC 3.4.23.46) (Beta-site APP| cleaving enzyme 1) (Beta-site amyloid precursor protein cleaving enzyme 1) (Aspartyl protease 2) (Asp 2) (ASP2) (Membrane-associated aspartic protease 2) (Memapsin-2) Length = 501 Score = 31.6 bits (70), Expect = 1.1 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +1 Query: 253 GYAFSLSLGTPPQPLPVLLDTGS 321 GY +++G+PPQ L +L+DTGS Sbjct: 74 GYYVEMTVGSPPQTLNILVDTGS 96
>BACE1_MOUSE (P56818) Beta-secretase 1 precursor (EC 3.4.23.46) (Beta-site APP| cleaving enzyme 1) (Beta-site amyloid precursor protein cleaving enzyme 1) (Aspartyl protease 2) (Asp 2) (ASP2) (Membrane-associated aspartic protease 2) (Memapsin-2) Length = 501 Score = 31.6 bits (70), Expect = 1.1 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +1 Query: 253 GYAFSLSLGTPPQPLPVLLDTGS 321 GY +++G+PPQ L +L+DTGS Sbjct: 74 GYYVEMTVGSPPQTLNILVDTGS 96
>BACE1_HUMAN (P56817) Beta-secretase 1 precursor (EC 3.4.23.46) (Beta-site APP| cleaving enzyme 1) (Beta-site amyloid precursor protein cleaving enzyme 1) (Aspartyl protease 2) (Asp 2) (ASP2) (Membrane-associated aspartic protease 2) (Memapsin-2) Length = 501 Score = 31.6 bits (70), Expect = 1.1 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +1 Query: 253 GYAFSLSLGTPPQPLPVLLDTGS 321 GY +++G+PPQ L +L+DTGS Sbjct: 74 GYYVEMTVGSPPQTLNILVDTGS 96
>AXP1_YARLI (Q92389) Acid extracellular protease precursor (EC 3.4.23.-)| Length = 397 Score = 31.6 bits (70), Expect = 1.1 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +1 Query: 205 AASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQ 363 A+S P+ A LY + Y +SLG Q + +DTGS + WV + CQ Sbjct: 45 ASSGPITAELY-NELMAYQVQISLGG--QTISASIDTGSEILWVWENDSIACQ 94
>CARP2_CANAL (P28871) Candidapepsin-2 precursor (EC 3.4.23.24) (Aspartate| protease 2) (ACP 2) (Secreted aspartic protease 2) Length = 398 Score = 31.6 bits (70), Expect = 1.1 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQ 363 YA +++G+ Q L V++DTGS WVP N CQ Sbjct: 70 YAADITVGSNNQKLNVIVDTGSSDLWVP-DVNVDCQ 104
>SXA1_SCHPO (P32834) Aspartic proteinase sxa1 precursor (EC 3.4.23.-)| Length = 533 Score = 30.8 bits (68), Expect = 1.9 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +1 Query: 250 GGYAFSLSLGTPPQPLPVLLDTGSHLTWV 336 GGY +L+LG+ + + LDTGS TWV Sbjct: 74 GGYFANLTLGSNERVYSLTLDTGSPYTWV 102
>YPS6_YEAST (P40583) Aspartic proteinase yapsin-6 precursor (EC 3.4.23.-)| Length = 537 Score = 30.4 bits (67), Expect = 2.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 250 GGYAFSLSLGTPPQPLPVLLDTGS 321 G Y + +GTPPQ L + LDTGS Sbjct: 65 GVYVVKMEIGTPPQTLYLQLDTGS 88
>PAG1_SHEEP (Q28755) Pregnancy-associated glycoprotein 1 precursor (EC| 3.4.23.-) (PAG 1) Length = 382 Score = 30.4 bits (67), Expect = 2.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y ++++GTPPQ V+ DTGS VP Sbjct: 71 YVGNITIGTPPQEFQVVFDTGSSDLLVP 98
>CARP4_CANAL (P43093) Candidapepsin-4 precursor (EC 3.4.23.24) (Aspartate| protease 4) (ACP 4) (Secreted aspartic protease 4) Length = 417 Score = 30.4 bits (67), Expect = 2.5 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQC 360 Y+ +++G+ Q L V++DTGS WVP SN C Sbjct: 89 YSADITIGSNNQKLSVIVDTGSSDLWVP-DSNAVC 122
>Y2573_YERPE (Q8ZDJ2) Hypothetical UPF0192 protein YPO2573/y1143/YP1141| precursor Length = 2004 Score = 30.0 bits (66), Expect = 3.3 Identities = 20/71 (28%), Positives = 31/71 (43%) Frame = +1 Query: 190 HHQGQAASSPVRAALYPHSYGGYAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNC 369 H +G +A+ + A ++ GY + L+ P +P P++ S P T NYQ Q Sbjct: 81 HPKGISAAIVLLMAAASAAFYGYHWYLNRPQPIEPAPMVYQETSIRVSAPRTVNYQAQKP 140 Query: 370 SAAAGSFPVFH 402 A S H Sbjct: 141 EAQPLSLNFMH 151
>VPRT_HTLV2 (P03353) Protease (EC 3.4.23.-)| Length = 178 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 274 LGTPPQPLPVLLDTGSHLTWVPCT 345 +G PQP LLDTG+ LT +P T Sbjct: 42 MGQTPQPTQALLDTGADLTVIPQT 65
>CARP_IRPLA (P17576) Polyporopepsin (EC 3.4.23.29) (Aspartic proteinase)| Length = 340 Score = 30.0 bits (66), Expect = 3.3 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQCQNCSAA 378 Y ++ +G+P +L+DTGS TW+ +Y + S+A Sbjct: 14 YVVNVGVGSPATTYSLLVDTGSSNTWLGADKSYVKTSTSSA 54
>CARP1_CANPA (P32951) Candidapepsin-1 precursor (EC 3.4.23.24) (Aspartate| protease 1) (ACP 1) Length = 402 Score = 29.6 bits (65), Expect = 4.3 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQC 360 YA +S+G+ Q V++DTGS WV SN QC Sbjct: 76 YASKVSVGSNKQQQTVIIDTGSSDFWV-VDSNAQC 109
>CARP1_CANAL (P28872) Candidapepsin-1 precursor (EC 3.4.23.24) (Aspartate| protease 1) (ACP 1) (Secreted aspartic protease 1) Length = 391 Score = 29.6 bits (65), Expect = 4.3 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTS 348 YA +++G+ Q V++DTGS WVP S Sbjct: 64 YAADITIGSNKQKFNVIVDTGSSDLWVPDAS 94
>YGZD_YEAST (P53057) Hypothetical protein YGL259W precursor| Length = 165 Score = 29.3 bits (64), Expect = 5.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 250 GGYAFSLSLGTPPQPLPVLLDTGS 321 G Y + +GTPPQ + + LDTGS Sbjct: 65 GVYVVKMEIGTPPQTVYLQLDTGS 88
>CARP5_CANAL (P43094) Candidapepsin-5 precursor (EC 3.4.23.24) (Aspartate| protease 5) (ACP 5) (Secreted aspartic protease 5) Length = 418 Score = 29.3 bits (64), Expect = 5.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVPCTSNYQC 360 Y +++G+ Q L V++DTGS W+P SN C Sbjct: 90 YTADITVGSDNQKLNVIVDTGSSDLWIP-DSNVIC 123
>CARP6_CANAL (P43095) Candidapepsin-6 precursor (EC 3.4.23.24) (Aspartate| protease 6) (ACP 6) (Secreted aspartic protease 6) Length = 418 Score = 28.9 bits (63), Expect = 7.3 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +1 Query: 256 YAFSLSLGTPPQPLPVLLDTGSHLTWVP 339 Y+ +++G+ Q L V++DTGS W+P Sbjct: 90 YSADITVGSNNQKLSVIVDTGSSDLWIP 117 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,062,912 Number of Sequences: 219361 Number of extensions: 339816 Number of successful extensions: 1301 Number of sequences better than 10.0: 111 Number of HSP's better than 10.0 without gapping: 1278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1298 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)