| Clone Name | bast77b10 |
|---|---|
| Clone Library Name | barley_pub |
>ARCA_BURPS (Q63U73) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 418 Score = 33.5 bits (75), Expect = 0.24 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = +2 Query: 239 VRAGLRDLPGSRFFESWDDGASAPCAYAGVVCAPDEDDPSGALLR---VSVLTLGT 397 V G D R E WDDG + C GVV D + + LLR V V+T+G+ Sbjct: 341 VETGGNDFAAER--EQWDDGNNMVCIEPGVVVGYDRNTYTNTLLRKAGVEVITIGS 394
>ARCA_BURMA (Q62KD9) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 418 Score = 33.5 bits (75), Expect = 0.24 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = +2 Query: 239 VRAGLRDLPGSRFFESWDDGASAPCAYAGVVCAPDEDDPSGALLR---VSVLTLGT 397 V G D R E WDDG + C GVV D + + LLR V V+T+G+ Sbjct: 341 VETGGNDFAAER--EQWDDGNNMVCIEPGVVVGYDRNTYTNTLLRKAGVEVITIGS 394
>ARCA_BRAJA (Q89DX7) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 420 Score = 30.4 bits (67), Expect = 2.0 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +2 Query: 287 WDDGASAPCAYAGVVCAPDEDDPSGALLR---VSVLTL 391 WD GA+ CA GVV A D + + LLR + V+T+ Sbjct: 357 WDSGANLVCASPGVVFAYDRNTYTNTLLRKEGIEVITI 394
>ARCA_RHILO (Q988I1) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 412 Score = 30.4 bits (67), Expect = 2.0 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +2 Query: 287 WDDGASAPCAYAGVVCAPDEDDPSGALLR---VSVLTL 391 WD GA+ CA GVV A D + + LLR + V+T+ Sbjct: 349 WDSGANLVCASPGVVYAYDRNTYTNTLLRKEGIEVITI 386
>ARCA2_RHIME (Q92YG5) Arginine deiminase 2 (EC 3.5.3.6) (ADI 2) (Arginine| dihydrolase 2) (AD 2) Length = 419 Score = 30.0 bits (66), Expect = 2.7 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = +2 Query: 287 WDDGASAPCAYAGVVCAPDEDDPSGALLR---VSVLTLGTGLSDSPGLAG 427 WD GA+ C GVV A D + + LLR V V+T+ TG G G Sbjct: 356 WDSGANLVCLSPGVVLAYDRNTYTNTLLRKAGVEVITI-TGAELGRGRGG 404
>ARCA_PSEAE (P13981) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 417 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +2 Query: 281 ESWDDGASAPCAYAGVVCAPDEDDPSGALLR---VSVLTL 391 E WDDG + C GVV D + + LLR V V+T+ Sbjct: 352 EQWDDGNNVVCLEPGVVVGYDRNTYTNTLLRKAGVEVITI 391
>GLGB_PSESM (Q881X0) 1,4-alpha-glucan branching enzyme (EC 2.4.1.18) (Glycogen| branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) Length = 741 Score = 28.9 bits (63), Expect = 5.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 70 SGCWEMDSTATGEWSEANWR 11 +G W+M+ G+W + NWR Sbjct: 262 AGSWQMEQNDEGQWRQYNWR 281
>ARCA_PSEPK (Q88P52) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 417 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +2 Query: 281 ESWDDGASAPCAYAGVVCAPDEDDPSGALLR---VSVLTLGTG 400 E WDDG + GVV D + + LLR + V+T+ G Sbjct: 352 EQWDDGNNVVAIEPGVVIGYDRNTYTNTLLRKAGIEVITISAG 394
>CASQ1_CHICK (P19204) Calsequestrin-1 precursor (Calsequestrin, skeletal muscle| isoform) (Aspartactin) (Laminin-binding protein) Length = 406 Score = 28.5 bits (62), Expect = 7.7 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = +2 Query: 242 RAGLRDLPGSRFFESWDDGASAPCAYAGVVCAPDEDDPSGALLRVSVLTLGTGLSDSPGL 421 RA LR L FE+W+D +V +EDDP G + + +D+P L Sbjct: 246 RATLRKLRPEDMFETWEDDMEG----IHIVAFAEEDDPDGFEFLEILKQVARDNTDNPDL 301 Query: 422 A 424 + Sbjct: 302 S 302
>ARCA_PSEPU (P41142) Arginine deiminase (EC 3.5.3.6) (ADI) (Arginine| dihydrolase) (AD) Length = 420 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = +2 Query: 281 ESWDDGASAPCAYAGVVCAPDEDDPSGALLR---VSVLTLGTG 400 E WDDG + GVV D + + LLR + V+T+ G Sbjct: 355 EQWDDGNNVVALEPGVVIGYDRNTYTNTLLRKAGIEVITISAG 397 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.122 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,358,350 Number of Sequences: 219361 Number of extensions: 480608 Number of successful extensions: 1663 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1662 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits)