| Clone Name | bast77b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SCOT_MOUSE (Q9D0K2) Succinyl-CoA:3-ketoacid-coenzyme A transfera... | 30 | 2.3 | 2 | PKN2_MYXXA (P54736) Serine/threonine-protein kinase pkn2 (EC 2.7... | 29 | 6.7 |
|---|
>SCOT_MOUSE (Q9D0K2) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1,| mitochondrial precursor (EC 2.8.3.5) (Somatic-type succinyl CoA:3-oxoacid CoA-transferase) (Scot-S) Length = 520 Score = 30.4 bits (67), Expect = 2.3 Identities = 22/66 (33%), Positives = 29/66 (43%) Frame = +2 Query: 257 ERRLMSGSKMKEMTGSGIFAEKXXXXXXXXXXPANRTSVRMYQQTVTGVSQISFSADGSV 436 ER+ +SG E+T G AE+ PA TS G S I ++ DGSV Sbjct: 123 ERQFLSGELEVELTPQGTLAER--IRAGGAGVPAFYTSTGYGTLVQEGGSPIKYNKDGSV 180 Query: 437 SPRSHP 454 + S P Sbjct: 181 AIASKP 186
>PKN2_MYXXA (P54736) Serine/threonine-protein kinase pkn2 (EC 2.7.11.1)| Length = 830 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +2 Query: 5 PEREAVTIEHGGQHSSGAMERATPVRSPHTSTA 103 P+ + T G SSG+ A P SPHT TA Sbjct: 337 PQASSGTAAFGVASSSGSASGALPAASPHTGTA 369 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,552,435 Number of Sequences: 219361 Number of extensions: 658242 Number of successful extensions: 1540 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1540 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)