| Clone Name | bast76g01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y498_MYCBO (P64712) Hypothetical protein Mb0498 | 33 | 0.23 | 2 | Y488_MYCTU (P64711) Hypothetical protein Rv0488/MT0507 | 33 | 0.23 | 3 | SOX17_MOUSE (Q61473) Transcription factor SOX-17 | 27 | 9.8 | 4 | PRR3_JUNVI (Q9LD79) Pathogenesis-related protein precursor (Puta... | 27 | 9.8 | 5 | MAGL2_HUMAN (Q9UJ55) MAGE-like protein 2 (Necdin-like protein 1)... | 27 | 9.8 | 6 | PRR3_JUNAS (P81295) Pathogenesis-related protein precursor (Poll... | 27 | 9.8 |
|---|
>Y498_MYCBO (P64712) Hypothetical protein Mb0498| Length = 201 Score = 32.7 bits (73), Expect = 0.23 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = -1 Query: 134 VRRRRGEAWLVGAALLTARVRFRPPAGATRKRGKACFIGLVSL 6 V R G A+L+G ALL AR +RP + G A IG+V + Sbjct: 60 VARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQM 102
>Y488_MYCTU (P64711) Hypothetical protein Rv0488/MT0507| Length = 201 Score = 32.7 bits (73), Expect = 0.23 Identities = 18/43 (41%), Positives = 24/43 (55%) Frame = -1 Query: 134 VRRRRGEAWLVGAALLTARVRFRPPAGATRKRGKACFIGLVSL 6 V R G A+L+G ALL AR +RP + G A IG+V + Sbjct: 60 VARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQM 102
>SOX17_MOUSE (Q61473) Transcription factor SOX-17| Length = 419 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 78 PSRQQRRTHQPRLPSPPPDGV 140 P +QQ H P PSPPP+ + Sbjct: 325 PPQQQHPAHGPGQPSPPPEAL 345
>PRR3_JUNVI (Q9LD79) Pathogenesis-related protein precursor (Putative major| pollen allergen Jun v 3) (Fragment) Length = 110 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 149 LPGDAVRRRRGEAWLVGAALLTARVRFRPPAGAT 48 LPG R +G+ W V A TA RF G T Sbjct: 37 LPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCT 70
>MAGL2_HUMAN (Q9UJ55) MAGE-like protein 2 (Necdin-like protein 1) (Protein nM15)| Length = 529 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 16 SPIKQAFPRFLVAPAGGRKRTLAVSSAAPTNHASPRRRRTAS 141 S QA P FL+A A + T A+ T+ PRR A+ Sbjct: 125 SKASQAVPTFLMATAAAPQATATTQEASKTSVEPPRRSGKAT 166
>PRR3_JUNAS (P81295) Pathogenesis-related protein precursor (Pollen allergen| Jun a 3) Length = 225 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 149 LPGDAVRRRRGEAWLVGAALLTARVRFRPPAGAT 48 LPG R +G+ W V A TA RF G T Sbjct: 44 LPGGGKRLDQGQTWTVNLAAGTASARFWGRTGCT 77 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,830,421 Number of Sequences: 219361 Number of extensions: 241091 Number of successful extensions: 1166 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1162 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)