| Clone Name | bast76e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLG_HCV1 (P26664) Genome polyprotein [Contains: Core protein p2... | 29 | 3.3 | 2 | SOX7_MOUSE (P40646) Transcription factor SOX-7 (mSOX7) | 27 | 9.6 | 3 | IF2_LACAC (Q5FJN6) Translation initiation factor IF-2 | 27 | 9.6 | 4 | SRP_DROME (P52172) Box A-binding factor (ABF) (GATA-binding fact... | 27 | 9.6 | 5 | POLG_HCVTW (P29846) Genome polyprotein [Contains: Core protein p... | 27 | 9.6 |
|---|
>POLG_HCV1 (P26664) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/NT Length = 3010 Score = 28.9 bits (63), Expect = 3.3 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +3 Query: 3 LLDPRAHTHISAHSAGRGSEKRATKKPPKVCAMAASQLTILSVLA 137 L DP +HI+A +AGR + A PP V + +ASQL+ S+ A Sbjct: 2174 LTDP---SHITAEAAGR---RLARGSPPSVASSSASQLSAPSLKA 2212
>SOX7_MOUSE (P40646) Transcription factor SOX-7 (mSOX7)| Length = 380 Score = 27.3 bits (59), Expect = 9.6 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 1 AYWTHAHTHTSQLTAQAEEARSEPPRNHPRF 93 AY++HA H QA + PP HP F Sbjct: 274 AYYSHATYHPLHPNLQAHLGQLSPPPEHPGF 304
>IF2_LACAC (Q5FJN6) Translation initiation factor IF-2| Length = 877 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 3 LLDPRAHTHISAHSAG 50 LLD HTH+SAH AG Sbjct: 396 LLDRLRHTHVSAHEAG 411
>SRP_DROME (P52172) Box A-binding factor (ABF) (GATA-binding factor-B)| (Transcription factor GATA-B) (dGATA-B) (Protein serpent) Length = 1264 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +2 Query: 11 PTRTHTHLSSQRRQRKREASHQETTQGLRNGRFSAHH 121 P +T HL Q Q++++ Q Q L+ + HH Sbjct: 522 PNQTQAHLQQQHHQQQQQQHQQHQQQQLQQQQQQHHH 558
>POLG_HCVTW (P29846) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3009 Score = 27.3 bits (59), Expect = 9.6 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +3 Query: 3 LLDPRAHTHISAHSAGRGSEKRATKKPPKVCAMAASQLTILSVLA 137 L DP +HI+A +A R + A PP + + +ASQL+ LS+ A Sbjct: 2174 LTDP---SHITAETAKR---RLARGSPPSLASSSASQLSALSLKA 2212 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.312 0.118 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,409,720 Number of Sequences: 219361 Number of extensions: 155709 Number of successful extensions: 691 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)