| Clone Name | bast76c11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZAN_MOUSE (O88799) Zonadhesin precursor | 29 | 2.5 | 2 | CEG1A_DROME (Q9NGC3) Centaurin-gamma 1A | 27 | 9.4 |
|---|
>ZAN_MOUSE (O88799) Zonadhesin precursor| Length = 5376 Score = 29.3 bits (64), Expect = 2.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 108 GHCRGGSKKMPGAS*S*CYCDP 43 GHC G S K P A C C+P Sbjct: 2842 GHCEGSSTKAPSACKEGCVCEP 2863 Score = 28.9 bits (63), Expect = 3.2 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = -1 Query: 114 SGGHCRGGSKKMPGAS*S*CYCDP 43 S GHC G + K P A C C+P Sbjct: 2960 SEGHCEGSTTKAPSACQEGCVCEP 2983 Score = 27.3 bits (59), Expect = 9.4 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 108 GHCRGGSKKMPGAS*S*CYCDP 43 GHC G + K P A C C+P Sbjct: 2602 GHCGGSTTKAPSACQEGCVCEP 2623
>CEG1A_DROME (Q9NGC3) Centaurin-gamma 1A| Length = 995 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 4 PHTLSSDQPQAHNRVTVALASASSGHFLASTTAMATADV 120 PH PQ HN A+++SG +S +A A+A + Sbjct: 28 PHQNQLPPPQRHNHAAPTAAASASGAPSSSASASASASI 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.307 0.113 0.302 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,034,766 Number of Sequences: 219361 Number of extensions: 241006 Number of successful extensions: 395 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)