| Clone Name | bast76b12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POLN_RUBVT (P13889) Nonstructural polyprotein [Contains: Proteas... | 35 | 0.057 | 2 | POLN_RUBVM (Q86500) Nonstructural polyprotein [Contains: Proteas... | 30 | 2.4 |
|---|
>POLN_RUBVT (P13889) Nonstructural polyprotein [Contains: Protease (EC| 3.4.22.-) (p150); RNA-directed RNA polymerase/helicase (EC 2.7.7.48) (EC 3.6.1.-) (p90)] Length = 2115 Score = 35.0 bits (79), Expect = 0.057 Identities = 18/30 (60%), Positives = 21/30 (70%) Frame = +1 Query: 19 AHVAGRTWQSDQRIAGRFCGNATAADSLSV 108 A+VA R WQS+ R+AG G AADSLSV Sbjct: 388 AYVAFRAWQSNARLAGIMKGAKCAADSLSV 417
>POLN_RUBVM (Q86500) Nonstructural polyprotein [Contains: Protease (EC| 3.4.22.-) (p150); RNA-directed RNA polymerase/helicase (EC 2.7.7.48) (EC 3.6.1.-) (p90)] Length = 2115 Score = 29.6 bits (65), Expect = 2.4 Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = +1 Query: 19 AHVAGRTWQSDQRIAGRF-CGNATAADSLSV 108 A+VA R WQS+ R+AG AADSLSV Sbjct: 388 AYVAFRAWQSNARLAGIMKSAKRCAADSLSV 418 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,107,516 Number of Sequences: 219361 Number of extensions: 248573 Number of successful extensions: 934 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 919 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 80,573,946 effective HSP length: 26 effective length of database: 74,870,560 effective search space used: 1796893440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)