| Clone Name | bast76b09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RP1L1_HUMAN (Q8IWN7) Retinitis pigmentosa 1-like 1 protein | 28 | 7.1 | 2 | STM1_YEAST (P39015) Suppressor protein STM1 (GU4 nucleic-binding... | 27 | 9.3 | 3 | DCDA_THEMA (Q9X1K5) Diaminopimelate decarboxylase (EC 4.1.1.20) ... | 27 | 9.3 |
|---|
>RP1L1_HUMAN (Q8IWN7) Retinitis pigmentosa 1-like 1 protein| Length = 2480 Score = 27.7 bits (60), Expect = 7.1 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -2 Query: 367 SGSSSRKTVTPPGLSACQ-SRESWPRPNTSSRIGARRRSTARE 242 +GSS + T PG S + +R+ P P+ GA RRS+A + Sbjct: 873 TGSSHQSTARGPGGSPQEGTRQPGPTPSPGPNSGASRRSSASQ 915
>STM1_YEAST (P39015) Suppressor protein STM1 (GU4 nucleic-binding protein 2)| (G4p2 protein) (Triplex-binding protein 1) (3BP1) (Ribosomal subunits association factor) (AF) (POP2 multicopy suppressor protein 4) (TOM1 suppressor protein 1) Length = 272 Score = 27.3 bits (59), Expect = 9.3 Identities = 17/47 (36%), Positives = 23/47 (48%) Frame = -2 Query: 361 SSSRKTVTPPGLSACQSRESWPRPNTSSRIGARRRSTAREREISAPD 221 SS + V PP ++R++ PRP S GA R TA R + D Sbjct: 30 SSKKADVPPPSADPSKARKNRPRP--SGNEGAIRDKTAGRRNNRSKD 74
>DCDA_THEMA (Q9X1K5) Diaminopimelate decarboxylase (EC 4.1.1.20) (DAP| decarboxylase) Length = 386 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 264 RAPIRLLVFGLGHDSRLWHALNPGGVTVFLEEDPE 368 R +R++ + +W LNP GV F+ +PE Sbjct: 102 REDVRIVNVDSFEEMEIWRELNPEGVEYFIRVNPE 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.125 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,626,106 Number of Sequences: 219361 Number of extensions: 318783 Number of successful extensions: 1119 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)