| Clone Name | bast76b03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CPR3_CAEEL (P43507) Cathepsin B-like cysteine proteinase 3 precu... | 30 | 1.9 | 2 | FOXL2_MOUSE (O88470) Forkhead box protein L2 (Pituitary forkhead... | 28 | 7.4 | 3 | FOXL2_HUMAN (P58012) Forkhead box protein L2 | 28 | 7.4 |
|---|
>CPR3_CAEEL (P43507) Cathepsin B-like cysteine proteinase 3 precursor (EC| 3.4.22.-) (Cysteine protease-related 3) Length = 370 Score = 29.6 bits (65), Expect = 1.9 Identities = 12/40 (30%), Positives = 23/40 (57%), Gaps = 5/40 (12%) Frame = +1 Query: 169 YELGDADLAFRL-----HYLRGVYYYAAGEVVRGVTTKVL 273 Y G + ++++ HY GVY+Y +G++V G K++ Sbjct: 250 YHYGPVEASYKVYEDFYHYKSGVYHYTSGKLVGGHAVKII 289
>FOXL2_MOUSE (O88470) Forkhead box protein L2 (Pituitary forkhead factor)| (P-Frk) Length = 375 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -3 Query: 119 PCTAAVASPSSPMPT-APRNSWVCVQAREFSLCECT 15 P + A A+P +P PT AP + C + E ++ C+ Sbjct: 323 PASPATAAPPAPAPTSAPGLQFACARQPELAMMHCS 358
>FOXL2_HUMAN (P58012) Forkhead box protein L2| Length = 376 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -3 Query: 119 PCTAAVASPSSPMPT-APRNSWVCVQAREFSLCECT 15 P + A A+P +P PT AP + C + E ++ C+ Sbjct: 324 PASPATAAPPAPAPTSAPGLQFACARQPELAMMHCS 359 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,726,333 Number of Sequences: 219361 Number of extensions: 333935 Number of successful extensions: 1372 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1372 length of database: 80,573,946 effective HSP length: 89 effective length of database: 61,050,817 effective search space used: 1465219608 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)