| Clone Name | bast76a09 |
|---|---|
| Clone Library Name | barley_pub |
>COGT2_ARATH (Q9SK82) Cytokinin-O-glucosyltransferase 2 (EC 2.4.1.-) (Zeatin| O-glucosyltransferase 2) Length = 489 Score = 32.3 bits (72), Expect = 0.32 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 125 EAPHFLVVTYPAQGHINP 178 + PH + V YPAQGHINP Sbjct: 10 QKPHVVCVPYPAQGHINP 27
>IAAG_MAIZE (Q41819) Indole-3-acetate beta-glucosyltransferase (EC 2.4.1.121)| (IAA-Glu synthetase) ((Uridine 5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl transferase) Length = 471 Score = 32.3 bits (72), Expect = 0.32 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 128 APHFLVVTYPAQGHINP 178 APH LVV +P QGH+NP Sbjct: 2 APHVLVVPFPGQGHMNP 18
>GRN_RAT (P23785) Granulins precursor [Contains: Acrogranin; Granulin-1| (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B) (Epithelin-2); Granulin-4 (Granulin A) (Epithelin-1); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Gran Length = 588 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -1 Query: 109 GRHCCVRAMRCECKKTRAYQVSKSVLTGVGCGG 11 G+HCC R C Q+S S+L V C G Sbjct: 95 GQHCCPRGFHCSADGKSCSQISDSLLGAVQCPG 127
>GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC cell-derived| growth factor) (PCDGF) [Contains: Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] Length = 589 Score = 28.1 bits (61), Expect = 6.0 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 Query: 109 GRHCCVRAMRCECKKTRAYQVSKSVLTGVGCGG 11 G HCC + C +Q+S + L V C G Sbjct: 95 GYHCCPQGFHCSADGKSCFQMSDNPLGAVQCPG 127
>DNAJ_CHLAB (Q5L6F7) Chaperone protein dnaJ| Length = 391 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = -2 Query: 159 AGYVTTRKCGASPTRSMAGIAACVRCDASAR 67 +GY T C S S GI C RC S + Sbjct: 156 SGYKTCETCSGSGASSKQGIKCCDRCKGSGQ 186
>MURG_BIFLO (Q8CY50) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)| pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase) Length = 393 Score = 27.7 bits (60), Expect = 7.8 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +2 Query: 131 PHFLVVTYPAQGHINPXXXXXXXXXXXTPGARVTV-STAVSACRKMFPD 274 PH ++ GH+NP P A+VTV TAV + + P+ Sbjct: 6 PHIVLAGGGTAGHVNPLLAVAGAIRDIEPTAQVTVIGTAVGLEKDLVPE 54 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,043,881 Number of Sequences: 219361 Number of extensions: 393541 Number of successful extensions: 1092 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1068 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1092 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)