| Clone Name | bast75g12 |
|---|---|
| Clone Library Name | barley_pub |
>SUR2_CAEEL (Q10669) Protein sur-2| Length = 1587 Score = 32.7 bits (73), Expect = 0.26 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = -2 Query: 146 LQHVVQRAPLVPLHLTQPPLAGVERADGHHLRH 48 +QH +Q+APL+P H PP + HHL+H Sbjct: 1422 MQHHLQQAPLLPSHQMMPPPQQHSSSLQHHLQH 1454
>Y4CG_RHISN (P55389) Probable DNA-invertase y4cG| Length = 305 Score = 30.0 bits (66), Expect = 1.7 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = +3 Query: 6 RVPKSLRE---GDERAYMPQ-VVSIGPLHAGKRRLREMERHKWRALHHVLKRTGHDVT 167 R P+++R ERAY+ + +VS RRLR RH W + +L R GHD T Sbjct: 159 RRPEAIRAVSAARERAYLDELIVSAQTWLPTVRRLRP--RHSWDNVVRILNRRGHDWT 214
>PUNA_CELSP (P81989) Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine| phosphorylase) (PNP) Length = 282 Score = 29.3 bits (64), Expect = 2.9 Identities = 23/59 (38%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = -2 Query: 176 EVGGDVVARALQHVVQ--RAPLVPLHLTQPPLAGVERADG--HHLRHVGALVALAEGLG 12 E+ G+VVA H + AP V HL+ VERADG H +G+ L EG G Sbjct: 53 ELLGEVVAEVPTHEIPGFSAPAVAGHLSVTRSIRVERADGSVRHALVLGSRTHLYEGKG 111
>TYR3_CAEEL (Q19673) Putative tyrosinase-like protein tyr-3 precursor| Length = 683 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 1 CTACPSPSARATSAPTCRRWCPSARSTPASGGCVRWSGTSG 123 C+ P+P+ R +RW AR+TP+ G V+ G +G Sbjct: 22 CSKAPTPAIRIM-CNQIQRWDQKARATPSLSGDVKTPGIAG 61
>TBCD_BOVIN (Q28205) Tubulin-specific chaperone D (Tubulin-folding cofactor D)| (Beta-tubulin cofactor D) Length = 1199 Score = 28.5 bits (62), Expect = 4.9 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = -2 Query: 164 DVVARALQHVVQRAPLVPLHLTQPPLAGVERADGHHLRHVGALVALAE 21 ++ A+AL+++ QRAP P L + ++ H RH GA++A AE Sbjct: 588 ELSAKALRNLAQRAPEHTAREVFPRLLSMTQSPDLHTRH-GAVLACAE 634
>Y181_TREPA (O83211) Hypothetical protein TP0181| Length = 147 Score = 28.1 bits (61), Expect = 6.4 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +3 Query: 96 LREMERHKWRALHHV--LKRTGHDVTAYLDALRPMEERV 206 +R +ER K +HH+ L G D+ A +DAL EE + Sbjct: 33 MRLLEREKKELVHHIQTLAERGRDLAAVVDALSFDEETI 71
>TBCD_HUMAN (Q9BTW9) Tubulin-specific chaperone D (Tubulin-folding cofactor D)| (Beta-tubulin cofactor D) (tfcD) (SSD-1) Length = 1192 Score = 28.1 bits (61), Expect = 6.4 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = -2 Query: 164 DVVARALQHVVQRAPLVPLHLTQPPLAGVERADGHHLRHVGALVALAE 21 ++ ARAL ++ Q+AP P L + + H+RH G+++A AE Sbjct: 581 ELAARALHNLAQQAPEFSATQVFPRLLSMTLSPDLHMRH-GSILACAE 627
>UVRA_PSEAE (Q9HWG0) UvrABC system protein A (UvrA protein) (Excinuclease ABC| subunit A) Length = 945 Score = 28.1 bits (61), Expect = 6.4 Identities = 16/64 (25%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Frame = +3 Query: 36 ERAYMPQVVSIGPLHAGKRRLREME--RHKWRALHHVLKRTGHDVTAYLDALRPMEERVR 209 E ++P + + GKR RE R+K +++H VL+ T + + DA+ + +++ Sbjct: 752 EMHFLPDIYVPCDVCKGKRYNRETLEIRYKGKSIHEVLEMTIEEAREFFDAVPALARKLQ 811 Query: 210 SCYD 221 + D Sbjct: 812 TLMD 815
>CU18B_LOCMI (P83995) Cuticle protein 18.6, isoform B (LM-18.6B) (LM-ACP 18.6B)| Length = 185 Score = 27.7 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 16 SPSARATSAPTCRRWCPSARSTPAS 90 +P ARA +AP R + P+ +TPA+ Sbjct: 34 APVARAYAAPVARAYAPAVAATPAA 58
>GTF2I_HUMAN (P78347) General transcription factor II-I (GTFII-I) (TFII-I)| (Bruton tyrosine kinase-associated protein 135) (BTK-associated protein 135) (BAP-135) (SRF-Phox1-interacting protein) (SPIN) (Williams-Beuren syndrome chromosome region 6 protein) Length = 998 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +3 Query: 48 MPQVVSIGPLHAGKRRLREMERHKWRA 128 +PQ P +AGKR++RE KW A Sbjct: 330 LPQPPVPEPANAGKRKVREFNFEKWNA 356 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,778,992 Number of Sequences: 219361 Number of extensions: 449043 Number of successful extensions: 2109 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2109 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)